Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397J691

Protein Details
Accession A0A397J691    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-33MIKKKTKVSRKKQEIKKIKKIKKNKNYGRFDVLBasic
NLS Segment(s)
PositionSequence
3-25KKKTKVSRKKQEIKKIKKIKKNK
Subcellular Location(s) nucl 15.5, cyto_nucl 10, mito 8
Family & Domain DBs
Amino Acid Sequences MIKKKTKVSRKKQEIKKIKKIKKNKNYGRFDVLVLEDLEHNQTKPISREVVGFKESHFYGDRLPRKNAILNSSRTRNGAALKFKRKNC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.93
3 0.93
4 0.92
5 0.91
6 0.9
7 0.91
8 0.91
9 0.9
10 0.91
11 0.9
12 0.9
13 0.88
14 0.83
15 0.79
16 0.69
17 0.59
18 0.5
19 0.4
20 0.3
21 0.22
22 0.17
23 0.11
24 0.1
25 0.11
26 0.09
27 0.09
28 0.08
29 0.09
30 0.1
31 0.11
32 0.13
33 0.13
34 0.13
35 0.17
36 0.19
37 0.21
38 0.21
39 0.2
40 0.18
41 0.2
42 0.19
43 0.18
44 0.17
45 0.14
46 0.18
47 0.27
48 0.34
49 0.36
50 0.39
51 0.39
52 0.4
53 0.46
54 0.44
55 0.41
56 0.41
57 0.43
58 0.47
59 0.5
60 0.49
61 0.45
62 0.43
63 0.39
64 0.4
65 0.4
66 0.44
67 0.48
68 0.57