Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397HSD3

Protein Details
Accession A0A397HSD3    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
206-254PYVKERGVKREERSKKQKIPKKEKQRLAVEKARKKELLAQKKKLKQQLVBasic
NLS Segment(s)
PositionSequence
209-250KERGVKREERSKKQKIPKKEKQRLAVEKARKKELLAQKKKLK
Subcellular Location(s) nucl 18.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR018305  Ribosomal_L50_mt  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF10501  Ribosomal_L50  
Amino Acid Sequences MSLLHSRREIIKYKVRQSHHKILKASFSHTPSSYGIFDFVKKLFPTVNKGNKGNKGNNNNIKENIDKIKNKNNLKEGQEVSSYEELLDEIEIEGVEGGVKQPTKLKDQSEIKSTIYNIYKNHVQSGVQWMDFKLENQSLKFTILRDCMSKTGRIIPNLNLNNMKTMSDVVRFYLGEEKRDSRIGHPVAEWFIANKDKLPPNMKFIPYVKERGVKREERSKKQKIPKKEKQRLAVEKARKKELLAQKKKLKQQLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.69
3 0.74
4 0.77
5 0.8
6 0.79
7 0.77
8 0.72
9 0.68
10 0.71
11 0.63
12 0.59
13 0.55
14 0.48
15 0.46
16 0.42
17 0.41
18 0.33
19 0.34
20 0.3
21 0.24
22 0.23
23 0.19
24 0.2
25 0.19
26 0.19
27 0.2
28 0.19
29 0.2
30 0.22
31 0.24
32 0.3
33 0.37
34 0.46
35 0.48
36 0.54
37 0.6
38 0.64
39 0.68
40 0.69
41 0.68
42 0.67
43 0.71
44 0.74
45 0.73
46 0.68
47 0.63
48 0.58
49 0.5
50 0.46
51 0.43
52 0.42
53 0.42
54 0.44
55 0.5
56 0.56
57 0.6
58 0.63
59 0.63
60 0.62
61 0.59
62 0.61
63 0.54
64 0.48
65 0.43
66 0.37
67 0.34
68 0.28
69 0.24
70 0.16
71 0.14
72 0.11
73 0.1
74 0.09
75 0.05
76 0.04
77 0.04
78 0.04
79 0.04
80 0.03
81 0.03
82 0.03
83 0.03
84 0.03
85 0.05
86 0.05
87 0.06
88 0.11
89 0.13
90 0.19
91 0.23
92 0.24
93 0.31
94 0.38
95 0.41
96 0.41
97 0.41
98 0.36
99 0.34
100 0.33
101 0.3
102 0.25
103 0.25
104 0.21
105 0.22
106 0.25
107 0.23
108 0.24
109 0.19
110 0.17
111 0.15
112 0.22
113 0.2
114 0.17
115 0.17
116 0.15
117 0.17
118 0.16
119 0.16
120 0.12
121 0.13
122 0.14
123 0.14
124 0.15
125 0.14
126 0.16
127 0.16
128 0.14
129 0.15
130 0.16
131 0.17
132 0.16
133 0.17
134 0.2
135 0.2
136 0.21
137 0.19
138 0.25
139 0.27
140 0.29
141 0.3
142 0.28
143 0.36
144 0.36
145 0.37
146 0.31
147 0.28
148 0.28
149 0.26
150 0.24
151 0.15
152 0.15
153 0.14
154 0.14
155 0.14
156 0.12
157 0.14
158 0.13
159 0.14
160 0.21
161 0.2
162 0.2
163 0.23
164 0.25
165 0.25
166 0.29
167 0.29
168 0.24
169 0.32
170 0.31
171 0.29
172 0.27
173 0.27
174 0.25
175 0.24
176 0.22
177 0.13
178 0.15
179 0.16
180 0.16
181 0.16
182 0.21
183 0.25
184 0.31
185 0.37
186 0.36
187 0.4
188 0.47
189 0.46
190 0.45
191 0.43
192 0.44
193 0.42
194 0.45
195 0.42
196 0.42
197 0.42
198 0.45
199 0.51
200 0.51
201 0.54
202 0.6
203 0.65
204 0.69
205 0.78
206 0.8
207 0.82
208 0.86
209 0.88
210 0.88
211 0.89
212 0.9
213 0.91
214 0.91
215 0.9
216 0.88
217 0.91
218 0.89
219 0.87
220 0.86
221 0.85
222 0.83
223 0.8
224 0.78
225 0.68
226 0.61
227 0.62
228 0.63
229 0.63
230 0.65
231 0.69
232 0.72
233 0.8
234 0.86