Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397J6G3

Protein Details
Accession A0A397J6G3    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
126-149PSNSVMKPKQKKQINNNNNNNPIAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR045123  METTL14-like  
IPR007757  MT-A70-like  
Gene Ontology GO:0005634  C:nucleus  
GO:0016070  P:RNA metabolic process  
Pfam View protein in Pfam  
PF05063  MT-A70  
PROSITE View protein in PROSITE  
PS51143  MT_A70  
Amino Acid Sequences MGIKGTVRRSTDGHFIHCNVDTDVIISEEPSFGSTCKPEELYHIIEHFCLGRRRLELFGEDHNIRPGWLTIGNELSSSNFDANTYTSKFSEPNGYLLGSTPEIENLRPKSPPPRDTSTPKLAGGVPSNSVMKPKQKKQINNNNNNNPIAVPPQIPQITPFPPRWIPPPPPPPQQQMDNNVYGKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.39
3 0.39
4 0.38
5 0.36
6 0.28
7 0.26
8 0.21
9 0.17
10 0.16
11 0.14
12 0.12
13 0.1
14 0.09
15 0.08
16 0.08
17 0.08
18 0.08
19 0.07
20 0.1
21 0.11
22 0.13
23 0.15
24 0.17
25 0.16
26 0.21
27 0.25
28 0.26
29 0.26
30 0.26
31 0.24
32 0.22
33 0.22
34 0.18
35 0.18
36 0.19
37 0.19
38 0.2
39 0.22
40 0.25
41 0.26
42 0.27
43 0.24
44 0.23
45 0.24
46 0.26
47 0.25
48 0.23
49 0.23
50 0.22
51 0.19
52 0.17
53 0.14
54 0.1
55 0.11
56 0.11
57 0.1
58 0.12
59 0.12
60 0.12
61 0.12
62 0.1
63 0.09
64 0.1
65 0.09
66 0.07
67 0.07
68 0.07
69 0.08
70 0.1
71 0.11
72 0.11
73 0.11
74 0.12
75 0.13
76 0.13
77 0.18
78 0.16
79 0.16
80 0.16
81 0.15
82 0.14
83 0.14
84 0.15
85 0.09
86 0.09
87 0.07
88 0.08
89 0.08
90 0.09
91 0.14
92 0.15
93 0.17
94 0.17
95 0.19
96 0.27
97 0.34
98 0.4
99 0.41
100 0.45
101 0.49
102 0.56
103 0.61
104 0.59
105 0.54
106 0.48
107 0.43
108 0.37
109 0.33
110 0.29
111 0.24
112 0.18
113 0.17
114 0.18
115 0.16
116 0.18
117 0.19
118 0.26
119 0.33
120 0.39
121 0.47
122 0.54
123 0.63
124 0.71
125 0.8
126 0.81
127 0.84
128 0.87
129 0.86
130 0.83
131 0.75
132 0.64
133 0.53
134 0.44
135 0.36
136 0.27
137 0.2
138 0.16
139 0.22
140 0.23
141 0.22
142 0.23
143 0.25
144 0.28
145 0.31
146 0.32
147 0.31
148 0.34
149 0.36
150 0.39
151 0.42
152 0.45
153 0.5
154 0.58
155 0.59
156 0.65
157 0.68
158 0.69
159 0.67
160 0.68
161 0.65
162 0.64
163 0.63
164 0.61