Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397G2D4

Protein Details
Accession A0A397G2D4    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-32VIIETRGESRKKKNRKRKASQRVIQQFRKSDHydrophilic
175-204HPDYTCCPNSKSKCRNPKCRNSKSQIPNYNHydrophilic
NLS Segment(s)
PositionSequence
10-23SRKKKNRKRKASQR
Subcellular Location(s) nucl 22, cyto_nucl 12.5, mito 4
Family & Domain DBs
Amino Acid Sequences MVIIETRGESRKKKNRKRKASQRVIQQFRKSDNEKSKQRMIKLRQDKNYNQAYNLVSKNKRQKKIEIRLTKDFLAKSKNIPLRVLEMDEEFNNTINNHATWPQKINQESSKNTLARFIDQTDLDELRELPCAACSRLHNNKNYKEIPLNEINLSLFKAPPELSDLSFEINFHYEHPDYTCCPNSKSKCRNPKCRNSKSQIPNYN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.85
3 0.9
4 0.95
5 0.95
6 0.96
7 0.96
8 0.92
9 0.92
10 0.92
11 0.9
12 0.87
13 0.84
14 0.78
15 0.72
16 0.74
17 0.67
18 0.66
19 0.66
20 0.67
21 0.68
22 0.69
23 0.73
24 0.7
25 0.73
26 0.74
27 0.71
28 0.72
29 0.74
30 0.76
31 0.75
32 0.78
33 0.75
34 0.73
35 0.75
36 0.65
37 0.56
38 0.51
39 0.44
40 0.42
41 0.42
42 0.41
43 0.35
44 0.41
45 0.51
46 0.56
47 0.62
48 0.6
49 0.67
50 0.69
51 0.77
52 0.8
53 0.79
54 0.76
55 0.75
56 0.74
57 0.66
58 0.59
59 0.49
60 0.42
61 0.37
62 0.31
63 0.27
64 0.32
65 0.34
66 0.32
67 0.32
68 0.3
69 0.29
70 0.29
71 0.27
72 0.19
73 0.16
74 0.16
75 0.15
76 0.15
77 0.11
78 0.1
79 0.09
80 0.08
81 0.08
82 0.08
83 0.08
84 0.07
85 0.11
86 0.12
87 0.13
88 0.16
89 0.19
90 0.23
91 0.24
92 0.26
93 0.29
94 0.33
95 0.34
96 0.36
97 0.38
98 0.34
99 0.33
100 0.34
101 0.28
102 0.25
103 0.25
104 0.21
105 0.18
106 0.17
107 0.18
108 0.16
109 0.16
110 0.13
111 0.12
112 0.11
113 0.1
114 0.11
115 0.1
116 0.07
117 0.09
118 0.11
119 0.11
120 0.14
121 0.16
122 0.23
123 0.33
124 0.38
125 0.44
126 0.51
127 0.55
128 0.6
129 0.59
130 0.55
131 0.51
132 0.48
133 0.46
134 0.42
135 0.39
136 0.32
137 0.31
138 0.27
139 0.22
140 0.21
141 0.16
142 0.11
143 0.09
144 0.11
145 0.1
146 0.1
147 0.15
148 0.15
149 0.15
150 0.18
151 0.18
152 0.19
153 0.19
154 0.19
155 0.15
156 0.15
157 0.14
158 0.12
159 0.17
160 0.15
161 0.16
162 0.19
163 0.21
164 0.22
165 0.28
166 0.34
167 0.31
168 0.34
169 0.43
170 0.49
171 0.57
172 0.65
173 0.69
174 0.74
175 0.82
176 0.9
177 0.91
178 0.93
179 0.93
180 0.93
181 0.94
182 0.91
183 0.91
184 0.9