Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397JNL1

Protein Details
Accession A0A397JNL1    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MPRVRKKVKSARKNIKIANRARLFHydrophilic
NLS Segment(s)
PositionSequence
4-17VRKKVKSARKNIKI
Subcellular Location(s) nucl 19.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
Amino Acid Sequences MPRVRKKVKSARKNIKIANRARLFQSKTVSASEIINLNTSSEEEPESDLDNEVFSFGAPDLDDENIALELFNKLFINENQLNQKKRVYYTGLSSRTNRRKNQQLRKAAVGTAQISKFFISCNQQETNSSLLIQNEQPNENNEEILDTSIQNDNNEDKIEDAIKFIENILLENXQKQLVH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.87
3 0.85
4 0.82
5 0.81
6 0.74
7 0.67
8 0.63
9 0.64
10 0.58
11 0.54
12 0.52
13 0.44
14 0.42
15 0.41
16 0.37
17 0.3
18 0.26
19 0.22
20 0.2
21 0.17
22 0.17
23 0.15
24 0.13
25 0.13
26 0.13
27 0.12
28 0.1
29 0.11
30 0.1
31 0.11
32 0.11
33 0.13
34 0.12
35 0.12
36 0.11
37 0.11
38 0.1
39 0.09
40 0.08
41 0.05
42 0.05
43 0.05
44 0.05
45 0.05
46 0.06
47 0.06
48 0.07
49 0.07
50 0.06
51 0.06
52 0.06
53 0.06
54 0.05
55 0.04
56 0.05
57 0.05
58 0.06
59 0.05
60 0.06
61 0.08
62 0.08
63 0.16
64 0.17
65 0.19
66 0.27
67 0.32
68 0.34
69 0.34
70 0.36
71 0.3
72 0.3
73 0.31
74 0.26
75 0.22
76 0.26
77 0.33
78 0.35
79 0.35
80 0.37
81 0.43
82 0.49
83 0.55
84 0.53
85 0.51
86 0.58
87 0.66
88 0.74
89 0.74
90 0.74
91 0.7
92 0.71
93 0.65
94 0.55
95 0.47
96 0.38
97 0.3
98 0.25
99 0.21
100 0.17
101 0.16
102 0.16
103 0.14
104 0.12
105 0.13
106 0.14
107 0.15
108 0.2
109 0.21
110 0.22
111 0.23
112 0.25
113 0.24
114 0.19
115 0.18
116 0.15
117 0.14
118 0.16
119 0.17
120 0.19
121 0.2
122 0.21
123 0.22
124 0.23
125 0.26
126 0.25
127 0.22
128 0.17
129 0.16
130 0.15
131 0.15
132 0.13
133 0.09
134 0.11
135 0.14
136 0.16
137 0.14
138 0.16
139 0.17
140 0.18
141 0.2
142 0.18
143 0.15
144 0.16
145 0.18
146 0.16
147 0.15
148 0.15
149 0.14
150 0.14
151 0.13
152 0.14
153 0.11
154 0.13
155 0.16
156 0.2
157 0.2
158 0.21