Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397JH93

Protein Details
Accession A0A397JH93    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
113-135NYGSILRNIKKKKLPKNKWKKLQHydrophilic
NLS Segment(s)
PositionSequence
120-135NIKKKKLPKNKWKKLQ
Subcellular Location(s) nucl 16, mito 8.5, cyto_mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
Amino Acid Sequences MRTNHYFREKEWRIVHCYSLTTKKVPELTEPREMTDWQLKKIKEVQKEPVIDSLKDAFKGRQHETKIIMIEGSCGAGKSTFVGKCKEYLTKYKKTVELDESFITKDSSKRIINYGSILRNIKKKKLPKNKWKKLQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.55
3 0.46
4 0.44
5 0.41
6 0.42
7 0.4
8 0.36
9 0.36
10 0.37
11 0.39
12 0.37
13 0.41
14 0.41
15 0.43
16 0.49
17 0.48
18 0.45
19 0.43
20 0.42
21 0.37
22 0.38
23 0.35
24 0.31
25 0.36
26 0.34
27 0.36
28 0.44
29 0.46
30 0.45
31 0.48
32 0.5
33 0.51
34 0.53
35 0.51
36 0.49
37 0.45
38 0.37
39 0.34
40 0.3
41 0.24
42 0.23
43 0.23
44 0.17
45 0.19
46 0.24
47 0.26
48 0.28
49 0.3
50 0.32
51 0.33
52 0.34
53 0.31
54 0.25
55 0.22
56 0.15
57 0.13
58 0.1
59 0.08
60 0.06
61 0.05
62 0.05
63 0.05
64 0.05
65 0.05
66 0.1
67 0.12
68 0.14
69 0.17
70 0.17
71 0.2
72 0.22
73 0.27
74 0.25
75 0.34
76 0.39
77 0.45
78 0.5
79 0.52
80 0.55
81 0.53
82 0.54
83 0.51
84 0.46
85 0.42
86 0.38
87 0.34
88 0.3
89 0.27
90 0.23
91 0.18
92 0.17
93 0.17
94 0.22
95 0.23
96 0.25
97 0.28
98 0.3
99 0.31
100 0.34
101 0.36
102 0.33
103 0.36
104 0.39
105 0.39
106 0.45
107 0.49
108 0.53
109 0.56
110 0.62
111 0.68
112 0.75
113 0.82
114 0.84
115 0.9