Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397GNW1

Protein Details
Accession A0A397GNW1    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
54-76NESRSVPFRKARKQDKMRIGRAMHydrophilic
NLS Segment(s)
PositionSequence
62-66RKARK
Subcellular Location(s) nucl 17.5, mito_nucl 13.666, cyto_nucl 10.333, mito 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007527  Znf_SWIM  
IPR039903  Zswim2  
Gene Ontology GO:0061630  F:ubiquitin protein ligase activity  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF04434  SWIM  
PROSITE View protein in PROSITE  
PS50966  ZF_SWIM  
Amino Acid Sequences MNTFERNLSNGEGSSTILGKRKTTDNEADLSTDGERKKVVKNVNGSSVTNKKGNESRSVPFRKARKQDKMRIGRAMTQFLHLIDYEIINPRLRKYSVLCPTGYVNTIVFSKTVSCSCPDFRLGFQCKHIYFVFLKVLKVSPRSKLIYQKELLAKELKLIFDNSPEVILPNKKEIEKLKAIALIKRRPIDGDCLVRREPLNNNEKLIWCQSGCGNNVHQDCFDEWKKRSVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.16
4 0.2
5 0.21
6 0.22
7 0.25
8 0.31
9 0.35
10 0.41
11 0.45
12 0.42
13 0.44
14 0.43
15 0.41
16 0.34
17 0.3
18 0.24
19 0.22
20 0.19
21 0.17
22 0.18
23 0.19
24 0.24
25 0.29
26 0.36
27 0.37
28 0.45
29 0.48
30 0.54
31 0.55
32 0.51
33 0.5
34 0.49
35 0.46
36 0.41
37 0.37
38 0.35
39 0.37
40 0.39
41 0.4
42 0.38
43 0.39
44 0.46
45 0.51
46 0.5
47 0.52
48 0.57
49 0.59
50 0.64
51 0.7
52 0.71
53 0.75
54 0.8
55 0.84
56 0.86
57 0.81
58 0.78
59 0.7
60 0.66
61 0.59
62 0.54
63 0.44
64 0.36
65 0.31
66 0.24
67 0.23
68 0.16
69 0.14
70 0.1
71 0.09
72 0.09
73 0.11
74 0.13
75 0.14
76 0.14
77 0.15
78 0.18
79 0.18
80 0.2
81 0.2
82 0.28
83 0.34
84 0.36
85 0.34
86 0.32
87 0.33
88 0.32
89 0.28
90 0.2
91 0.12
92 0.1
93 0.11
94 0.1
95 0.08
96 0.07
97 0.07
98 0.08
99 0.08
100 0.08
101 0.09
102 0.12
103 0.13
104 0.15
105 0.16
106 0.16
107 0.16
108 0.24
109 0.26
110 0.25
111 0.27
112 0.3
113 0.29
114 0.31
115 0.3
116 0.24
117 0.21
118 0.22
119 0.25
120 0.21
121 0.21
122 0.19
123 0.21
124 0.2
125 0.25
126 0.25
127 0.22
128 0.26
129 0.3
130 0.33
131 0.4
132 0.43
133 0.45
134 0.43
135 0.46
136 0.45
137 0.43
138 0.41
139 0.34
140 0.29
141 0.26
142 0.27
143 0.21
144 0.18
145 0.19
146 0.17
147 0.17
148 0.18
149 0.14
150 0.13
151 0.12
152 0.12
153 0.13
154 0.16
155 0.16
156 0.2
157 0.23
158 0.23
159 0.28
160 0.31
161 0.35
162 0.37
163 0.36
164 0.34
165 0.36
166 0.37
167 0.37
168 0.41
169 0.41
170 0.42
171 0.43
172 0.41
173 0.38
174 0.38
175 0.41
176 0.4
177 0.42
178 0.4
179 0.42
180 0.43
181 0.43
182 0.42
183 0.39
184 0.4
185 0.4
186 0.44
187 0.42
188 0.44
189 0.45
190 0.46
191 0.45
192 0.41
193 0.36
194 0.28
195 0.27
196 0.28
197 0.31
198 0.3
199 0.3
200 0.3
201 0.34
202 0.36
203 0.37
204 0.33
205 0.3
206 0.3
207 0.34
208 0.38
209 0.38
210 0.38