Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397IAX1

Protein Details
Accession A0A397IAX1    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
45-67YFTKPYGPPKSRKTKCHECENEFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR044650  SRFR1-like  
IPR011990  TPR-like_helical_dom_sf  
IPR001440  TPR_1  
IPR019734  TPR_repeat  
IPR003656  Znf_BED  
IPR036236  Znf_C2H2_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046872  F:metal ion binding  
GO:0045892  P:negative regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF00515  TPR_1  
PF13414  TPR_11  
PF13181  TPR_8  
PF02892  zf-BED  
PROSITE View protein in PROSITE  
PS50005  TPR  
PS50293  TPR_REGION  
PS50808  ZF_BED  
Amino Acid Sequences MKAVLILSLQLITLFNPNSSTSLHREPELHHLTLMSNTKSKVWDYFTKPYGPPKSRKTKCHECENEFSYHGSTSSMNYHLTHKHNIDTSTNSVHVTDQICENQNRPLQLLNLEQKNADILFAESWFFDILDKILKINRNDKDNKDAIIIRGKFYLKMGKYKESIADSNKVLEIEPNNVKVLIRRGEAYLMGRKYEKSIGDLSRALKIEPNNINALIRRGVSYLKMGNYEETIADLSSAIKINPNDAGLLKNRGDSYRKIGKYEESIADLNKALEIETNNNVYILISRGKTYKEMKRYKESVVDLNKAIEIEPNNIKALRIREEMEIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.15
4 0.16
5 0.17
6 0.19
7 0.22
8 0.24
9 0.31
10 0.32
11 0.33
12 0.34
13 0.35
14 0.43
15 0.45
16 0.39
17 0.31
18 0.3
19 0.29
20 0.32
21 0.35
22 0.28
23 0.26
24 0.26
25 0.28
26 0.3
27 0.31
28 0.29
29 0.3
30 0.36
31 0.4
32 0.47
33 0.48
34 0.52
35 0.52
36 0.57
37 0.61
38 0.6
39 0.61
40 0.63
41 0.71
42 0.73
43 0.8
44 0.8
45 0.81
46 0.8
47 0.83
48 0.82
49 0.78
50 0.78
51 0.73
52 0.67
53 0.56
54 0.51
55 0.41
56 0.31
57 0.25
58 0.18
59 0.15
60 0.13
61 0.15
62 0.15
63 0.16
64 0.16
65 0.2
66 0.25
67 0.29
68 0.33
69 0.31
70 0.33
71 0.35
72 0.36
73 0.35
74 0.33
75 0.32
76 0.29
77 0.28
78 0.25
79 0.22
80 0.2
81 0.21
82 0.18
83 0.15
84 0.15
85 0.17
86 0.21
87 0.21
88 0.22
89 0.25
90 0.25
91 0.25
92 0.24
93 0.22
94 0.19
95 0.21
96 0.26
97 0.26
98 0.26
99 0.26
100 0.25
101 0.23
102 0.23
103 0.21
104 0.14
105 0.08
106 0.07
107 0.07
108 0.07
109 0.07
110 0.06
111 0.07
112 0.07
113 0.06
114 0.05
115 0.05
116 0.05
117 0.08
118 0.08
119 0.08
120 0.11
121 0.16
122 0.18
123 0.26
124 0.29
125 0.35
126 0.4
127 0.42
128 0.46
129 0.43
130 0.41
131 0.36
132 0.33
133 0.28
134 0.31
135 0.29
136 0.23
137 0.24
138 0.24
139 0.21
140 0.21
141 0.26
142 0.19
143 0.25
144 0.27
145 0.28
146 0.29
147 0.3
148 0.31
149 0.27
150 0.29
151 0.24
152 0.25
153 0.21
154 0.21
155 0.2
156 0.18
157 0.14
158 0.14
159 0.12
160 0.13
161 0.15
162 0.15
163 0.15
164 0.15
165 0.15
166 0.15
167 0.19
168 0.16
169 0.15
170 0.15
171 0.16
172 0.16
173 0.17
174 0.18
175 0.2
176 0.17
177 0.18
178 0.18
179 0.18
180 0.19
181 0.22
182 0.19
183 0.16
184 0.21
185 0.21
186 0.24
187 0.26
188 0.25
189 0.26
190 0.26
191 0.23
192 0.21
193 0.2
194 0.25
195 0.26
196 0.27
197 0.24
198 0.24
199 0.25
200 0.23
201 0.24
202 0.17
203 0.14
204 0.13
205 0.12
206 0.13
207 0.13
208 0.15
209 0.16
210 0.16
211 0.17
212 0.17
213 0.17
214 0.17
215 0.17
216 0.13
217 0.11
218 0.11
219 0.08
220 0.08
221 0.07
222 0.06
223 0.07
224 0.08
225 0.07
226 0.11
227 0.11
228 0.12
229 0.14
230 0.14
231 0.13
232 0.13
233 0.16
234 0.15
235 0.2
236 0.19
237 0.21
238 0.22
239 0.24
240 0.27
241 0.27
242 0.32
243 0.38
244 0.39
245 0.38
246 0.39
247 0.4
248 0.41
249 0.44
250 0.38
251 0.32
252 0.31
253 0.3
254 0.29
255 0.26
256 0.21
257 0.16
258 0.14
259 0.1
260 0.11
261 0.12
262 0.14
263 0.17
264 0.19
265 0.18
266 0.18
267 0.18
268 0.16
269 0.15
270 0.14
271 0.15
272 0.14
273 0.15
274 0.18
275 0.2
276 0.26
277 0.34
278 0.4
279 0.46
280 0.55
281 0.61
282 0.68
283 0.7
284 0.7
285 0.7
286 0.65
287 0.63
288 0.61
289 0.58
290 0.5
291 0.47
292 0.42
293 0.34
294 0.3
295 0.26
296 0.2
297 0.22
298 0.25
299 0.26
300 0.28
301 0.28
302 0.29
303 0.29
304 0.33
305 0.33
306 0.32
307 0.33