Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397IDP8

Protein Details
Accession A0A397IDP8    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
117-143QPKQLRDWIKNKNKLLRAKPHVKRLATHydrophilic
NLS Segment(s)
PositionSequence
127-142NKNKLLRAKPHVKRLA
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR007889  HTH_Psq  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF04218  CENP-B_N  
Amino Acid Sequences MSNNEIPNNSFDSKNLNIIIGDERNHIYDHEHEPDNHHKGSGSGPRPHLDDHHGNDYDHEQVDYEKDYNNDHDHKQRDEELISSAEQNAQEKLAIITYFERSPNASKRNTVEKFNIQPKQLRDWIKNKNKLLRAKPHVKRLATGSKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.28
3 0.23
4 0.2
5 0.21
6 0.25
7 0.21
8 0.21
9 0.19
10 0.19
11 0.19
12 0.2
13 0.19
14 0.17
15 0.19
16 0.23
17 0.25
18 0.26
19 0.26
20 0.31
21 0.39
22 0.41
23 0.37
24 0.32
25 0.27
26 0.26
27 0.31
28 0.34
29 0.32
30 0.33
31 0.35
32 0.36
33 0.38
34 0.38
35 0.34
36 0.32
37 0.32
38 0.3
39 0.34
40 0.34
41 0.32
42 0.32
43 0.31
44 0.27
45 0.2
46 0.16
47 0.1
48 0.09
49 0.1
50 0.11
51 0.1
52 0.09
53 0.09
54 0.11
55 0.13
56 0.17
57 0.18
58 0.19
59 0.25
60 0.27
61 0.27
62 0.28
63 0.28
64 0.26
65 0.23
66 0.22
67 0.17
68 0.15
69 0.14
70 0.12
71 0.11
72 0.1
73 0.1
74 0.11
75 0.09
76 0.08
77 0.08
78 0.08
79 0.08
80 0.08
81 0.07
82 0.07
83 0.08
84 0.1
85 0.12
86 0.12
87 0.12
88 0.13
89 0.19
90 0.26
91 0.3
92 0.3
93 0.32
94 0.37
95 0.46
96 0.47
97 0.47
98 0.45
99 0.48
100 0.54
101 0.59
102 0.6
103 0.52
104 0.56
105 0.54
106 0.56
107 0.55
108 0.54
109 0.52
110 0.57
111 0.65
112 0.69
113 0.75
114 0.75
115 0.77
116 0.78
117 0.8
118 0.8
119 0.8
120 0.8
121 0.81
122 0.81
123 0.83
124 0.84
125 0.76
126 0.7
127 0.67