Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397JK93

Protein Details
Accession A0A397JK93    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
12-59IKESTLPTRKRGRPRKEKVTTSTSTPAVTSRKRVRPRKVQKVEDRTTAHydrophilic
NLS Segment(s)
PositionSequence
20-29RKRGRPRKEK
42-49RKRVRPRK
Subcellular Location(s) nucl 16.5, mito_nucl 12.666, cyto_nucl 10.833, mito 7.5
Family & Domain DBs
Amino Acid Sequences MNNNMDNSTSPIKESTLPTRKRGRPRKEKVTTSTSTPAVTSRKRVRPRKVQKVEDRTTADLRKIPNIKKIYYEILSFYCRWN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.33
3 0.38
4 0.42
5 0.47
6 0.57
7 0.63
8 0.7
9 0.76
10 0.76
11 0.78
12 0.84
13 0.88
14 0.87
15 0.86
16 0.81
17 0.78
18 0.69
19 0.63
20 0.57
21 0.46
22 0.37
23 0.3
24 0.27
25 0.25
26 0.25
27 0.27
28 0.31
29 0.39
30 0.49
31 0.58
32 0.64
33 0.7
34 0.79
35 0.83
36 0.85
37 0.85
38 0.86
39 0.87
40 0.82
41 0.78
42 0.71
43 0.63
44 0.59
45 0.52
46 0.44
47 0.38
48 0.35
49 0.36
50 0.4
51 0.4
52 0.43
53 0.45
54 0.44
55 0.46
56 0.48
57 0.46
58 0.41
59 0.39
60 0.33
61 0.32
62 0.35