Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397IZB5

Protein Details
Accession A0A397IZB5    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
40-62TEKEIRKREEGNKKKSKNKMVIQBasic
NLS Segment(s)
PositionSequence
45-57RKREEGNKKKSKN
Subcellular Location(s) nucl 16.5, cyto_nucl 12.833, cyto 8, cyto_pero 4.833
Family & Domain DBs
Amino Acid Sequences MDEWIDRLMNEMNEGDEEEEEEEEEDDNVDYDDVDDVDDTEKEIRKREEGNKKKSKNKMVIQVNSNGQVFESSSQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.12
3 0.09
4 0.1
5 0.09
6 0.08
7 0.08
8 0.08
9 0.07
10 0.07
11 0.07
12 0.06
13 0.05
14 0.05
15 0.05
16 0.05
17 0.04
18 0.04
19 0.04
20 0.04
21 0.04
22 0.04
23 0.04
24 0.05
25 0.05
26 0.05
27 0.07
28 0.1
29 0.11
30 0.15
31 0.17
32 0.19
33 0.26
34 0.35
35 0.44
36 0.51
37 0.61
38 0.68
39 0.74
40 0.8
41 0.83
42 0.83
43 0.82
44 0.79
45 0.79
46 0.78
47 0.77
48 0.72
49 0.69
50 0.63
51 0.57
52 0.5
53 0.39
54 0.3
55 0.24
56 0.21