Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397IYW5

Protein Details
Accession A0A397IYW5    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
88-107IIWMTRKKTLKSNINYKKKKHydrophilic
NLS Segment(s)
PositionSequence
104-107KKKK
Subcellular Location(s) nucl 15, mito 4, cyto 3, pero 3, cyto_pero 3
Family & Domain DBs
Amino Acid Sequences MDADVQILSRLMSGQVYDLLRRTRGRPDLQSERKGTKVGELVLLLLSIIAVKIEDSSGTNRCRHSFSEISNISNIVANIYLSCTEFGIIWMTRKKTLKSNINYKKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.12
3 0.13
4 0.14
5 0.18
6 0.2
7 0.24
8 0.26
9 0.28
10 0.32
11 0.38
12 0.43
13 0.45
14 0.51
15 0.58
16 0.63
17 0.68
18 0.64
19 0.6
20 0.55
21 0.51
22 0.42
23 0.35
24 0.3
25 0.23
26 0.2
27 0.16
28 0.15
29 0.13
30 0.13
31 0.09
32 0.05
33 0.04
34 0.03
35 0.03
36 0.02
37 0.02
38 0.02
39 0.02
40 0.03
41 0.03
42 0.04
43 0.07
44 0.12
45 0.15
46 0.17
47 0.19
48 0.21
49 0.23
50 0.24
51 0.28
52 0.27
53 0.27
54 0.34
55 0.34
56 0.34
57 0.32
58 0.3
59 0.23
60 0.21
61 0.19
62 0.09
63 0.08
64 0.07
65 0.07
66 0.08
67 0.08
68 0.07
69 0.08
70 0.07
71 0.07
72 0.07
73 0.08
74 0.11
75 0.11
76 0.16
77 0.21
78 0.24
79 0.31
80 0.35
81 0.38
82 0.43
83 0.52
84 0.57
85 0.61
86 0.7
87 0.74