Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397G3U3

Protein Details
Accession A0A397G3U3    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
46-78MKQKLLKKLVRRRKNFVKKLRKLFNKPKPEDDMBasic
NLS Segment(s)
PositionSequence
48-73QKLLKKLVRRRKNFVKKLRKLFNKPK
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 4
Family & Domain DBs
Amino Acid Sequences MGEGILIHQTSYIKLTDRGYKEKFITVWCPNDQMAIFINKDIKLTMKQKLLKKLVRRRKNFVKKLRKLFNKPKPEDDMDFCCCGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.19
3 0.26
4 0.31
5 0.38
6 0.39
7 0.43
8 0.42
9 0.42
10 0.4
11 0.35
12 0.37
13 0.34
14 0.36
15 0.32
16 0.33
17 0.29
18 0.3
19 0.26
20 0.2
21 0.16
22 0.14
23 0.13
24 0.12
25 0.14
26 0.12
27 0.12
28 0.11
29 0.12
30 0.14
31 0.17
32 0.22
33 0.26
34 0.32
35 0.37
36 0.46
37 0.53
38 0.54
39 0.61
40 0.66
41 0.7
42 0.74
43 0.76
44 0.76
45 0.8
46 0.85
47 0.85
48 0.85
49 0.86
50 0.86
51 0.89
52 0.91
53 0.9
54 0.89
55 0.9
56 0.89
57 0.89
58 0.85
59 0.82
60 0.79
61 0.75
62 0.7
63 0.65
64 0.61
65 0.55