Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397IVG9

Protein Details
Accession A0A397IVG9    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
2-34FYLFTNKKSNPKNFLKHYKRSSKIENNNKNNSNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, mito_nucl 13.666, cyto_nucl 11.833, mito 5.5
Family & Domain DBs
Amino Acid Sequences MFYLFTNKKSNPKNFLKHYKRSSKIENNNKNNSNGNGSELTRQIKEFQWIYPRPKCLREIMSYHSKSHRRVESADEVYELLSQERSRLQELYVKCAANGCWKDVP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.82
3 0.82
4 0.83
5 0.84
6 0.85
7 0.83
8 0.8
9 0.8
10 0.8
11 0.81
12 0.82
13 0.83
14 0.81
15 0.83
16 0.8
17 0.73
18 0.65
19 0.57
20 0.5
21 0.4
22 0.34
23 0.27
24 0.25
25 0.24
26 0.23
27 0.23
28 0.19
29 0.19
30 0.18
31 0.17
32 0.2
33 0.19
34 0.19
35 0.25
36 0.29
37 0.35
38 0.37
39 0.42
40 0.4
41 0.42
42 0.42
43 0.38
44 0.38
45 0.35
46 0.34
47 0.33
48 0.41
49 0.4
50 0.41
51 0.44
52 0.44
53 0.44
54 0.48
55 0.48
56 0.41
57 0.41
58 0.45
59 0.46
60 0.44
61 0.41
62 0.33
63 0.29
64 0.26
65 0.25
66 0.19
67 0.11
68 0.1
69 0.09
70 0.1
71 0.14
72 0.16
73 0.17
74 0.18
75 0.19
76 0.23
77 0.25
78 0.3
79 0.32
80 0.29
81 0.27
82 0.29
83 0.29
84 0.33
85 0.33