Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397IH60

Protein Details
Accession A0A397IH60    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
34-57REREREREREKKERERERENQSKNBasic
NLS Segment(s)
PositionSequence
101-114REREREREKKERER
Subcellular Location(s) nucl 12.5, cyto_nucl 9.5, cyto 5.5, cysk 4, mito 3
Family & Domain DBs
Amino Acid Sequences MWTLCIIILNYCVREMRERERERERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLNYCVREMREREREREREKKERERERENQSKNLYYAIVNIYISRYA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.26
3 0.31
4 0.4
5 0.43
6 0.49
7 0.56
8 0.62
9 0.6
10 0.65
11 0.58
12 0.56
13 0.58
14 0.54
15 0.48
16 0.46
17 0.44
18 0.42
19 0.44
20 0.44
21 0.49
22 0.5
23 0.55
24 0.58
25 0.64
26 0.64
27 0.69
28 0.68
29 0.67
30 0.72
31 0.75
32 0.77
33 0.8
34 0.8
35 0.79
36 0.8
37 0.8
38 0.82
39 0.76
40 0.74
41 0.69
42 0.65
43 0.57
44 0.5
45 0.41
46 0.31
47 0.29
48 0.23
49 0.2
50 0.16
51 0.16