Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397HB35

Protein Details
Accession A0A397HB35    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
23-42GIRHRALTTRLQRKKRKIGTBasic
NLS Segment(s)
PositionSequence
35-39RKKRK
Subcellular Location(s) mito 15.5, mito_nucl 13.333, nucl 10, cyto_nucl 6.333
Family & Domain DBs
Amino Acid Sequences MSSCRNHSQSGTLGKFFRRITNGIRHRALTTRLQRKKRKIGTISGIKSYHEWTWPDQGEYIGFIYVRISPEIGEWKKWASTQIEKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.43
3 0.4
4 0.39
5 0.33
6 0.32
7 0.35
8 0.43
9 0.49
10 0.5
11 0.51
12 0.47
13 0.45
14 0.45
15 0.43
16 0.41
17 0.43
18 0.47
19 0.53
20 0.61
21 0.68
22 0.74
23 0.81
24 0.8
25 0.79
26 0.72
27 0.7
28 0.69
29 0.69
30 0.62
31 0.56
32 0.49
33 0.4
34 0.37
35 0.32
36 0.25
37 0.19
38 0.19
39 0.16
40 0.23
41 0.24
42 0.24
43 0.22
44 0.21
45 0.18
46 0.18
47 0.16
48 0.09
49 0.08
50 0.07
51 0.07
52 0.09
53 0.1
54 0.1
55 0.09
56 0.09
57 0.12
58 0.21
59 0.23
60 0.23
61 0.24
62 0.26
63 0.27
64 0.28
65 0.31
66 0.29