Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397H7R1

Protein Details
Accession A0A397H7R1    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
9-35VTVACRNCQKAKKKCSDYKQNPSCERCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 12.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MNKTNRTHVTVACRNCQKAKKKCSDYKQNPSCERCVKKGLECEYIQSVLKRGRRQIHVNESNRLSEDDNNISRDDDIFDLSRKYGLHFNAVRDLKETYPNEPFDLMMKTLTATTNKKCPNDVNHICHAGCFITD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.61
3 0.65
4 0.66
5 0.68
6 0.73
7 0.75
8 0.79
9 0.84
10 0.87
11 0.9
12 0.89
13 0.9
14 0.88
15 0.87
16 0.85
17 0.79
18 0.76
19 0.74
20 0.69
21 0.62
22 0.61
23 0.55
24 0.52
25 0.55
26 0.53
27 0.49
28 0.45
29 0.43
30 0.38
31 0.36
32 0.32
33 0.24
34 0.23
35 0.23
36 0.28
37 0.28
38 0.32
39 0.38
40 0.42
41 0.48
42 0.52
43 0.57
44 0.61
45 0.61
46 0.59
47 0.54
48 0.49
49 0.43
50 0.36
51 0.27
52 0.19
53 0.19
54 0.18
55 0.18
56 0.19
57 0.18
58 0.17
59 0.16
60 0.15
61 0.13
62 0.09
63 0.09
64 0.09
65 0.09
66 0.1
67 0.1
68 0.11
69 0.1
70 0.11
71 0.14
72 0.14
73 0.21
74 0.23
75 0.25
76 0.32
77 0.33
78 0.31
79 0.29
80 0.3
81 0.24
82 0.3
83 0.29
84 0.25
85 0.29
86 0.3
87 0.3
88 0.28
89 0.27
90 0.21
91 0.22
92 0.18
93 0.13
94 0.12
95 0.11
96 0.12
97 0.14
98 0.17
99 0.2
100 0.24
101 0.33
102 0.39
103 0.41
104 0.44
105 0.48
106 0.5
107 0.56
108 0.61
109 0.58
110 0.58
111 0.61
112 0.57
113 0.5
114 0.44