Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397IGD5

Protein Details
Accession A0A397IGD5    Localization Confidence High Confidence Score 22.8
NoLS Segment(s)
PositionSequenceProtein Nature
4-29VAVKKELKDINRKRNGKRNSTNVKIGHydrophilic
72-93FIMLSIRRYRRKKKEDLEGYWNHydrophilic
100-119SEGYWDLRYRRKKIRKATGIHydrophilic
NLS Segment(s)
PositionSequence
15-20RKRNGK
82-83RK
109-115RRKKIRK
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
Amino Acid Sequences MSNVAVKKELKDINRKRNGKRNSTNVKIGMKKEEVFAYGFEGNSNQYNEEYSKECSGDDNNILGFEVRVFYFIMLSIRRYRRKKKEDLEGYWNFEKKEDSEGYWDLRYRRKKIRKATGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.77
3 0.78
4 0.82
5 0.85
6 0.84
7 0.83
8 0.83
9 0.82
10 0.8
11 0.78
12 0.74
13 0.72
14 0.67
15 0.6
16 0.55
17 0.49
18 0.43
19 0.39
20 0.34
21 0.27
22 0.23
23 0.2
24 0.18
25 0.15
26 0.14
27 0.12
28 0.12
29 0.12
30 0.13
31 0.14
32 0.1
33 0.1
34 0.11
35 0.12
36 0.13
37 0.14
38 0.14
39 0.14
40 0.14
41 0.14
42 0.14
43 0.14
44 0.14
45 0.13
46 0.11
47 0.1
48 0.09
49 0.09
50 0.08
51 0.07
52 0.05
53 0.05
54 0.04
55 0.05
56 0.05
57 0.05
58 0.05
59 0.06
60 0.08
61 0.08
62 0.11
63 0.17
64 0.25
65 0.34
66 0.43
67 0.53
68 0.61
69 0.7
70 0.78
71 0.78
72 0.82
73 0.82
74 0.81
75 0.8
76 0.73
77 0.71
78 0.66
79 0.6
80 0.49
81 0.4
82 0.36
83 0.28
84 0.3
85 0.25
86 0.22
87 0.25
88 0.28
89 0.3
90 0.31
91 0.34
92 0.31
93 0.38
94 0.45
95 0.48
96 0.57
97 0.64
98 0.7
99 0.78