Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397IEM9

Protein Details
Accession A0A397IEM9    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
8-39DQSNQSNQPNQPNRRKKKKKTTTQPNSRLTVQHydrophilic
NLS Segment(s)
PositionSequence
21-27RRKKKKK
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MNGHNQQDQSNQSNQPNQPNRRKKKKKTTTQPNSRLTVQLVTCYQGSGYRTAVVVFFAVERKSAFASLCQQTTCKRIYIYI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.54
3 0.58
4 0.63
5 0.68
6 0.74
7 0.8
8 0.83
9 0.91
10 0.91
11 0.93
12 0.94
13 0.94
14 0.94
15 0.95
16 0.95
17 0.95
18 0.93
19 0.88
20 0.81
21 0.7
22 0.6
23 0.5
24 0.42
25 0.31
26 0.24
27 0.18
28 0.16
29 0.14
30 0.13
31 0.12
32 0.1
33 0.11
34 0.11
35 0.11
36 0.1
37 0.1
38 0.11
39 0.11
40 0.09
41 0.08
42 0.06
43 0.06
44 0.08
45 0.08
46 0.09
47 0.09
48 0.1
49 0.11
50 0.12
51 0.12
52 0.13
53 0.2
54 0.24
55 0.26
56 0.25
57 0.26
58 0.29
59 0.33
60 0.32
61 0.28