Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397H188

Protein Details
Accession A0A397H188    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
57-86MENNKQLIKDDKKKNHAKLKKEIDKIKEKIBasic
NLS Segment(s)
PositionSequence
68-89KKKNHAKLKKEIDKIKEKIKKL
Subcellular Location(s) nucl 21.5, cyto_nucl 14, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MSKQNKQNAVDIQILKFKLSQLEKKFQETDVLISELLSLKPNATIYYQKSDTNIFFMENNKQLIKDDKKKNHAKLKKEIDKIKEKIKKLEAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.32
3 0.28
4 0.25
5 0.25
6 0.29
7 0.35
8 0.36
9 0.45
10 0.47
11 0.51
12 0.52
13 0.45
14 0.43
15 0.35
16 0.31
17 0.23
18 0.22
19 0.17
20 0.15
21 0.15
22 0.11
23 0.11
24 0.1
25 0.07
26 0.06
27 0.07
28 0.08
29 0.08
30 0.09
31 0.13
32 0.14
33 0.19
34 0.21
35 0.2
36 0.21
37 0.23
38 0.21
39 0.2
40 0.18
41 0.13
42 0.13
43 0.15
44 0.18
45 0.18
46 0.2
47 0.18
48 0.18
49 0.19
50 0.27
51 0.34
52 0.39
53 0.47
54 0.54
55 0.63
56 0.72
57 0.8
58 0.83
59 0.81
60 0.79
61 0.8
62 0.82
63 0.82
64 0.82
65 0.8
66 0.78
67 0.8
68 0.77
69 0.77
70 0.75
71 0.7
72 0.7