Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K1WTC3

Protein Details
Accession K1WTC3    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
175-232SEPAEKVSKKKPKLTKKEKAKLNAEGEANREKIDKKAAKKAKKIKMKQKQLAAKAAKRHydrophilic
NLS Segment(s)
PositionSequence
180-234KVSKKKPKLTKKEKAKLNAEGEANREKIDKKAAKKAKKIKMKQKQLAAKAAKREA
Subcellular Location(s) nucl 17.5, cyto_nucl 13.833, mito_nucl 9.666, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR011082  Exosome-assoc_fac/DNA_repair  
IPR007146  Sas10/Utp3/C1D  
Gene Ontology GO:0005634  C:nucleus  
GO:0003723  F:RNA binding  
GO:0006364  P:rRNA processing  
KEGG mbe:MBM_06285  -  
Pfam View protein in Pfam  
PF04000  Sas10_Utp3  
Amino Acid Sequences MDSTKVMSLLETLDDEIDDLEESLEPLIKVALSETASKLPLLDKAKLYILVTYAIESMLFSYLRLHGVKARDHPVFKELTRVKQYFDKIKNIENPLERTMAVDRAAAARFIKAGLAGNDKYDLVRAEKIAKERAIAHIKFNEPSKDAEKKRKAGELEAPADEDSSSDSESSPESSEPAEKVSKKKPKLTKKEKAKLNAEGEANREKIDKKAAKKAKKIKMKQKQLAAKAAKREA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.09
4 0.08
5 0.07
6 0.06
7 0.06
8 0.06
9 0.06
10 0.07
11 0.08
12 0.07
13 0.07
14 0.07
15 0.07
16 0.07
17 0.07
18 0.1
19 0.1
20 0.12
21 0.14
22 0.16
23 0.17
24 0.16
25 0.16
26 0.14
27 0.2
28 0.22
29 0.24
30 0.23
31 0.24
32 0.26
33 0.28
34 0.27
35 0.21
36 0.18
37 0.16
38 0.15
39 0.13
40 0.11
41 0.09
42 0.09
43 0.08
44 0.07
45 0.07
46 0.07
47 0.06
48 0.07
49 0.09
50 0.12
51 0.12
52 0.12
53 0.15
54 0.19
55 0.23
56 0.26
57 0.31
58 0.32
59 0.33
60 0.34
61 0.32
62 0.32
63 0.28
64 0.33
65 0.3
66 0.33
67 0.4
68 0.39
69 0.39
70 0.41
71 0.46
72 0.45
73 0.47
74 0.47
75 0.42
76 0.46
77 0.5
78 0.48
79 0.48
80 0.42
81 0.41
82 0.35
83 0.34
84 0.29
85 0.24
86 0.21
87 0.18
88 0.15
89 0.11
90 0.1
91 0.11
92 0.11
93 0.1
94 0.09
95 0.08
96 0.07
97 0.07
98 0.07
99 0.05
100 0.06
101 0.07
102 0.1
103 0.1
104 0.11
105 0.11
106 0.11
107 0.11
108 0.11
109 0.1
110 0.08
111 0.09
112 0.1
113 0.13
114 0.15
115 0.18
116 0.2
117 0.2
118 0.19
119 0.2
120 0.26
121 0.3
122 0.28
123 0.29
124 0.29
125 0.3
126 0.31
127 0.33
128 0.28
129 0.22
130 0.24
131 0.27
132 0.32
133 0.36
134 0.44
135 0.49
136 0.52
137 0.54
138 0.56
139 0.52
140 0.48
141 0.5
142 0.46
143 0.42
144 0.37
145 0.35
146 0.29
147 0.28
148 0.24
149 0.16
150 0.1
151 0.08
152 0.08
153 0.07
154 0.07
155 0.08
156 0.09
157 0.1
158 0.1
159 0.09
160 0.09
161 0.1
162 0.12
163 0.12
164 0.15
165 0.2
166 0.22
167 0.28
168 0.37
169 0.46
170 0.51
171 0.6
172 0.66
173 0.71
174 0.79
175 0.84
176 0.85
177 0.87
178 0.9
179 0.89
180 0.88
181 0.84
182 0.81
183 0.75
184 0.7
185 0.62
186 0.55
187 0.51
188 0.47
189 0.41
190 0.33
191 0.3
192 0.26
193 0.25
194 0.34
195 0.37
196 0.39
197 0.49
198 0.58
199 0.65
200 0.74
201 0.81
202 0.81
203 0.85
204 0.88
205 0.89
206 0.9
207 0.91
208 0.9
209 0.89
210 0.89
211 0.85
212 0.85
213 0.83
214 0.78