Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397JKE9

Protein Details
Accession A0A397JKE9    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
29-54RIYPIYSPKKKQEKKRIDLQPNINDIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito_nucl 13, mito 11.5
Family & Domain DBs
Amino Acid Sequences MSRREFWFVGTVVDWHNRAISFPIDLSDRIYPIYSPKKKQEKKRIDLQPNINDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.16
3 0.17
4 0.15
5 0.15
6 0.15
7 0.13
8 0.11
9 0.1
10 0.11
11 0.11
12 0.11
13 0.13
14 0.11
15 0.1
16 0.1
17 0.1
18 0.09
19 0.15
20 0.25
21 0.29
22 0.34
23 0.44
24 0.55
25 0.63
26 0.74
27 0.78
28 0.79
29 0.8
30 0.85
31 0.86
32 0.84
33 0.86
34 0.85