Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397IWJ6

Protein Details
Accession A0A397IWJ6    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
119-140DHIKTTAATRKKKSEKSEKNESHydrophilic
NLS Segment(s)
PositionSequence
85-92KTRKGKKR
Subcellular Location(s) cyto 11.5, cyto_nucl 11, nucl 7.5, E.R. 3, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR005595  TRAP_alpha  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
Pfam View protein in Pfam  
PF03896  TRAP_alpha  
Amino Acid Sequences MDHVDITYNFYAEFKPQEYDLILYVLFVNKDKKQFKGVGFNETVTIVDPDQSIFDLQLIFLYLILSGFALGTGYMIFQAFFGGAKTRKGKKRPTTRSVDDPAVGISTSSDKYDEDWIPDHIKTTAATRKKKSEKSEKNES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.17
4 0.19
5 0.2
6 0.2
7 0.18
8 0.16
9 0.13
10 0.11
11 0.12
12 0.11
13 0.11
14 0.12
15 0.16
16 0.18
17 0.27
18 0.3
19 0.32
20 0.36
21 0.41
22 0.43
23 0.49
24 0.47
25 0.45
26 0.44
27 0.42
28 0.36
29 0.31
30 0.27
31 0.17
32 0.16
33 0.09
34 0.08
35 0.08
36 0.07
37 0.07
38 0.07
39 0.07
40 0.06
41 0.06
42 0.05
43 0.05
44 0.05
45 0.05
46 0.04
47 0.04
48 0.04
49 0.04
50 0.03
51 0.04
52 0.03
53 0.03
54 0.03
55 0.02
56 0.02
57 0.02
58 0.02
59 0.02
60 0.02
61 0.03
62 0.03
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.04
69 0.08
70 0.09
71 0.13
72 0.2
73 0.28
74 0.36
75 0.43
76 0.53
77 0.6
78 0.7
79 0.76
80 0.78
81 0.79
82 0.77
83 0.78
84 0.73
85 0.65
86 0.54
87 0.45
88 0.37
89 0.28
90 0.22
91 0.14
92 0.09
93 0.09
94 0.09
95 0.1
96 0.1
97 0.09
98 0.11
99 0.17
100 0.18
101 0.18
102 0.2
103 0.22
104 0.25
105 0.25
106 0.25
107 0.19
108 0.19
109 0.17
110 0.22
111 0.28
112 0.34
113 0.43
114 0.48
115 0.58
116 0.67
117 0.75
118 0.78
119 0.81
120 0.83