Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397IZC7

Protein Details
Accession A0A397IZC7    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
32-60MLPPTLFSPSRRRRRRQRPGPYNRARFTNHydrophilic
NLS Segment(s)
PositionSequence
41-51SRRRRRRQRPG
Subcellular Location(s) nucl 26, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR047134  RNF4-like  
IPR001841  Znf_RING  
IPR013083  Znf_RING/FYVE/PHD  
IPR017907  Znf_RING_CS  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
GO:0016740  F:transferase activity  
GO:0016567  P:protein ubiquitination  
Pfam View protein in Pfam  
PF13920  zf-C3HC4_3  
PROSITE View protein in PROSITE  
PS00518  ZF_RING_1  
PS50089  ZF_RING_2  
Amino Acid Sequences MPSNNNQQQLILPPNFSSPSRPSRPSRPPQLMLPPTLFSPSRRRRRRQRPGPYNRARFTNTVNCTICLSPPNSAVVTPCGHTFCHRCLSNWTQRSLTCPVCRAGIHPIPTQRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.29
3 0.28
4 0.27
5 0.26
6 0.33
7 0.39
8 0.44
9 0.47
10 0.54
11 0.64
12 0.68
13 0.72
14 0.71
15 0.68
16 0.67
17 0.72
18 0.65
19 0.57
20 0.5
21 0.41
22 0.33
23 0.33
24 0.28
25 0.21
26 0.29
27 0.36
28 0.45
29 0.53
30 0.62
31 0.7
32 0.81
33 0.89
34 0.89
35 0.91
36 0.91
37 0.93
38 0.94
39 0.93
40 0.9
41 0.8
42 0.73
43 0.64
44 0.54
45 0.49
46 0.46
47 0.39
48 0.37
49 0.36
50 0.33
51 0.32
52 0.31
53 0.26
54 0.2
55 0.19
56 0.14
57 0.14
58 0.15
59 0.13
60 0.13
61 0.14
62 0.14
63 0.14
64 0.13
65 0.14
66 0.13
67 0.13
68 0.17
69 0.2
70 0.2
71 0.28
72 0.28
73 0.28
74 0.34
75 0.43
76 0.49
77 0.5
78 0.51
79 0.45
80 0.45
81 0.48
82 0.47
83 0.46
84 0.39
85 0.38
86 0.36
87 0.36
88 0.36
89 0.33
90 0.36
91 0.35
92 0.36
93 0.39