Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397JN78

Protein Details
Accession A0A397JN78    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
34-55IQIKILRKRRKLKDSSSKTKSVHydrophilic
NLS Segment(s)
PositionSequence
40-46RKRRKLK
Subcellular Location(s) nucl 25.5, cyto_nucl 15
Family & Domain DBs
Amino Acid Sequences MRRILKELEEETDKVLNEATKRRKLKEDDNSEDIQIKILRKRRKLKDSSSKTKSVDILSINKYIKRISAIM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.19
4 0.18
5 0.27
6 0.32
7 0.39
8 0.43
9 0.47
10 0.53
11 0.57
12 0.63
13 0.64
14 0.66
15 0.63
16 0.63
17 0.61
18 0.53
19 0.49
20 0.39
21 0.3
22 0.22
23 0.18
24 0.18
25 0.25
26 0.32
27 0.39
28 0.49
29 0.57
30 0.65
31 0.71
32 0.76
33 0.8
34 0.83
35 0.85
36 0.81
37 0.78
38 0.69
39 0.65
40 0.58
41 0.48
42 0.42
43 0.36
44 0.36
45 0.33
46 0.38
47 0.37
48 0.36
49 0.35
50 0.32
51 0.3