Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397IMD5

Protein Details
Accession A0A397IMD5    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
71-97DSRRKLKNTAMNDKKKRRRRAVDFMMQHydrophilic
NLS Segment(s)
PositionSequence
73-90RRKLKNTAMNDKKKRRRR
Subcellular Location(s) nucl 21, cyto_nucl 12.5, mito 2, cyto 2, pero 2
Family & Domain DBs
Amino Acid Sequences MNTVYQINDHLTWVAQKHDVITKLLLSLKRKINKKYKVTGAEIIKMLQRRHWSRHRVNNIGNQGPRAVINDSRRKLKNTAMNDKKKRRRRAVDFMMQGGNKYIKRYLKKDLSKILNNSDYYSEEWEETDDGTTATARTAAASTSATRTTTIIDSDNDTDNNNNNNNNNNMVQLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.17
3 0.17
4 0.19
5 0.24
6 0.25
7 0.24
8 0.24
9 0.21
10 0.22
11 0.26
12 0.28
13 0.27
14 0.32
15 0.39
16 0.45
17 0.52
18 0.59
19 0.65
20 0.7
21 0.75
22 0.76
23 0.76
24 0.75
25 0.73
26 0.71
27 0.64
28 0.58
29 0.5
30 0.42
31 0.36
32 0.34
33 0.3
34 0.27
35 0.32
36 0.33
37 0.41
38 0.49
39 0.56
40 0.61
41 0.71
42 0.75
43 0.73
44 0.73
45 0.73
46 0.7
47 0.66
48 0.57
49 0.47
50 0.39
51 0.32
52 0.27
53 0.21
54 0.17
55 0.16
56 0.23
57 0.31
58 0.33
59 0.39
60 0.41
61 0.43
62 0.43
63 0.45
64 0.45
65 0.44
66 0.53
67 0.55
68 0.64
69 0.7
70 0.78
71 0.81
72 0.83
73 0.85
74 0.84
75 0.84
76 0.82
77 0.83
78 0.81
79 0.8
80 0.72
81 0.64
82 0.58
83 0.47
84 0.39
85 0.3
86 0.25
87 0.17
88 0.17
89 0.19
90 0.22
91 0.28
92 0.32
93 0.39
94 0.46
95 0.51
96 0.55
97 0.59
98 0.6
99 0.61
100 0.6
101 0.57
102 0.53
103 0.47
104 0.42
105 0.36
106 0.3
107 0.25
108 0.25
109 0.2
110 0.15
111 0.14
112 0.14
113 0.13
114 0.12
115 0.11
116 0.08
117 0.07
118 0.07
119 0.07
120 0.06
121 0.06
122 0.06
123 0.05
124 0.06
125 0.06
126 0.06
127 0.07
128 0.09
129 0.1
130 0.12
131 0.14
132 0.14
133 0.15
134 0.15
135 0.16
136 0.16
137 0.17
138 0.16
139 0.16
140 0.19
141 0.21
142 0.23
143 0.21
144 0.21
145 0.22
146 0.25
147 0.29
148 0.29
149 0.31
150 0.31
151 0.36
152 0.38
153 0.4
154 0.35