Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397I5P6

Protein Details
Accession A0A397I5P6    Localization Confidence High Confidence Score 20.4
NoLS Segment(s)
PositionSequenceProtein Nature
31-54QTHDCNTKKVKKGKASKEKGECDDHydrophilic
134-160TILPIPSKNPQKPRSRLQENRKEKASEHydrophilic
NLS Segment(s)
PositionSequence
39-47KVKKGKASK
70-82KVKKRKASKGKAS
118-130VKKGKASKEKASE
140-151SKNPQKPRSRLQ
154-154R
Subcellular Location(s) nucl 25, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MVERKIPNPRSRLQENKGKEGNQVRKKEEPQTHDCNTKKVKKGKASKEKGECDDSTDSKEEPQTYDHIEKVKKRKASKGKASEEKEKILTPIHPFVCRSDDSTDSEEEPQTHDHIEKVKKGKASKEKASEEKVTILPIPSKNPQKPRSRLQENRKEKASEEKDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.69
3 0.71
4 0.71
5 0.64
6 0.62
7 0.62
8 0.66
9 0.65
10 0.67
11 0.63
12 0.65
13 0.69
14 0.71
15 0.68
16 0.66
17 0.64
18 0.65
19 0.64
20 0.65
21 0.62
22 0.6
23 0.61
24 0.62
25 0.63
26 0.63
27 0.67
28 0.68
29 0.77
30 0.8
31 0.82
32 0.82
33 0.82
34 0.83
35 0.8
36 0.75
37 0.7
38 0.59
39 0.52
40 0.49
41 0.4
42 0.35
43 0.3
44 0.26
45 0.22
46 0.24
47 0.2
48 0.16
49 0.17
50 0.16
51 0.19
52 0.2
53 0.2
54 0.23
55 0.26
56 0.31
57 0.39
58 0.43
59 0.45
60 0.47
61 0.55
62 0.6
63 0.67
64 0.7
65 0.71
66 0.73
67 0.76
68 0.77
69 0.76
70 0.68
71 0.6
72 0.51
73 0.41
74 0.34
75 0.26
76 0.24
77 0.19
78 0.22
79 0.22
80 0.22
81 0.22
82 0.23
83 0.25
84 0.23
85 0.22
86 0.19
87 0.2
88 0.22
89 0.23
90 0.23
91 0.21
92 0.22
93 0.2
94 0.17
95 0.17
96 0.15
97 0.13
98 0.13
99 0.12
100 0.13
101 0.19
102 0.23
103 0.28
104 0.32
105 0.35
106 0.39
107 0.42
108 0.5
109 0.53
110 0.58
111 0.6
112 0.64
113 0.67
114 0.69
115 0.71
116 0.65
117 0.56
118 0.52
119 0.44
120 0.37
121 0.3
122 0.26
123 0.26
124 0.24
125 0.28
126 0.32
127 0.41
128 0.47
129 0.56
130 0.62
131 0.67
132 0.73
133 0.77
134 0.8
135 0.81
136 0.84
137 0.85
138 0.87
139 0.87
140 0.87
141 0.84
142 0.75
143 0.66
144 0.67