Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K1XDG1

Protein Details
Accession K1XDG1    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
89-112ALPGRISKAYKRQRRAESRLPGILHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 10, mito 7, cyto 6, cyto_nucl 6, nucl 4
Family & Domain DBs
KEGG mbe:MBM_03155  -  
Amino Acid Sequences MCSRTVIGRFSRTDNYSLDAGSITSLISIYGDEMDISRFRIMLGHSEQAKGDFNDSIYLNDGNDFTFAARAGKVSVIMTEFNALLFSAALPGRISKAYKRQRRAESRLPGILEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.35
3 0.3
4 0.27
5 0.23
6 0.16
7 0.14
8 0.11
9 0.09
10 0.06
11 0.05
12 0.05
13 0.04
14 0.04
15 0.04
16 0.04
17 0.04
18 0.04
19 0.04
20 0.05
21 0.06
22 0.07
23 0.08
24 0.08
25 0.08
26 0.08
27 0.09
28 0.1
29 0.13
30 0.15
31 0.18
32 0.19
33 0.2
34 0.2
35 0.19
36 0.21
37 0.16
38 0.14
39 0.1
40 0.09
41 0.11
42 0.11
43 0.1
44 0.1
45 0.1
46 0.09
47 0.09
48 0.09
49 0.07
50 0.06
51 0.06
52 0.05
53 0.05
54 0.05
55 0.06
56 0.05
57 0.06
58 0.06
59 0.06
60 0.07
61 0.07
62 0.07
63 0.08
64 0.08
65 0.08
66 0.09
67 0.08
68 0.07
69 0.08
70 0.07
71 0.06
72 0.05
73 0.05
74 0.06
75 0.07
76 0.07
77 0.07
78 0.08
79 0.1
80 0.13
81 0.15
82 0.19
83 0.3
84 0.4
85 0.5
86 0.58
87 0.66
88 0.74
89 0.82
90 0.85
91 0.84
92 0.84
93 0.81
94 0.78