Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1XD62

Protein Details
Accession K1XD62    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
23-79VLKPKTEKAKVEKPKSEKPKVAKPKAPKKEKVENEEKEAKPKKKAVKKDKEEKDEDGBasic
NLS Segment(s)
PositionSequence
25-72KPKTEKAKVEKPKSEKPKVAKPKAPKKEKVENEEKEAKPKKKAVKKDK
94-103KAKTEGKAKV
Subcellular Location(s) cyto 14, cyto_nucl 13, nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR010776  Hop2_WH_dom  
IPR036388  WH-like_DNA-bd_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0090304  P:nucleic acid metabolic process  
KEGG mbe:MBM_03000  -  
Pfam View protein in Pfam  
PF07106  TBPIP  
Amino Acid Sequences MAPRKPKAEDDAASTTSTDLPAVLKPKTEKAKVEKPKSEKPKVAKPKAPKKEKVENEEKEAKPKKKAVKKDKEEKDEDGDFDMDADAAVSKPAKAKTEGKAKVESKAVGGGGAVGKGDGKEKVKPVNGEEAMELIRAYLKRENRPYSATEISANLHGKISECWLIVIPTVYMKVTKTVADKLLKDMEQSGQIKGKATKSGTGGQWVFWPIQDPADSASPEELAAMDTAIEALRERMPAIKASLKSLRAKLDALRTAPTTVDLAAAIERMQEENVAKKERLLAFQQGTVKTVTTEEVENVEKDLKYWGGKRTARKRAFEAVEGQLREGMTKEDIWDKAGIEEDTY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.33
3 0.26
4 0.23
5 0.16
6 0.1
7 0.1
8 0.14
9 0.18
10 0.18
11 0.22
12 0.25
13 0.34
14 0.42
15 0.46
16 0.51
17 0.55
18 0.65
19 0.71
20 0.78
21 0.78
22 0.77
23 0.82
24 0.84
25 0.85
26 0.83
27 0.8
28 0.81
29 0.82
30 0.85
31 0.82
32 0.83
33 0.84
34 0.87
35 0.89
36 0.87
37 0.85
38 0.85
39 0.86
40 0.84
41 0.84
42 0.78
43 0.76
44 0.77
45 0.69
46 0.69
47 0.69
48 0.65
49 0.62
50 0.66
51 0.67
52 0.67
53 0.77
54 0.78
55 0.8
56 0.84
57 0.88
58 0.9
59 0.88
60 0.84
61 0.77
62 0.72
63 0.64
64 0.54
65 0.46
66 0.36
67 0.27
68 0.22
69 0.18
70 0.11
71 0.08
72 0.07
73 0.05
74 0.04
75 0.05
76 0.05
77 0.06
78 0.11
79 0.13
80 0.16
81 0.2
82 0.26
83 0.32
84 0.43
85 0.48
86 0.47
87 0.54
88 0.52
89 0.51
90 0.49
91 0.42
92 0.32
93 0.29
94 0.25
95 0.16
96 0.15
97 0.12
98 0.09
99 0.08
100 0.07
101 0.05
102 0.05
103 0.05
104 0.07
105 0.09
106 0.11
107 0.14
108 0.18
109 0.23
110 0.27
111 0.28
112 0.29
113 0.35
114 0.33
115 0.31
116 0.28
117 0.23
118 0.2
119 0.18
120 0.16
121 0.07
122 0.08
123 0.08
124 0.1
125 0.14
126 0.19
127 0.26
128 0.34
129 0.39
130 0.39
131 0.41
132 0.41
133 0.42
134 0.39
135 0.33
136 0.26
137 0.22
138 0.2
139 0.22
140 0.2
141 0.14
142 0.13
143 0.12
144 0.12
145 0.11
146 0.12
147 0.1
148 0.1
149 0.09
150 0.09
151 0.1
152 0.09
153 0.09
154 0.07
155 0.05
156 0.06
157 0.05
158 0.06
159 0.05
160 0.07
161 0.08
162 0.09
163 0.11
164 0.13
165 0.18
166 0.21
167 0.21
168 0.22
169 0.25
170 0.23
171 0.21
172 0.2
173 0.16
174 0.19
175 0.2
176 0.19
177 0.18
178 0.19
179 0.21
180 0.22
181 0.23
182 0.22
183 0.22
184 0.23
185 0.23
186 0.27
187 0.26
188 0.29
189 0.27
190 0.23
191 0.23
192 0.21
193 0.19
194 0.14
195 0.15
196 0.1
197 0.11
198 0.11
199 0.1
200 0.11
201 0.13
202 0.13
203 0.11
204 0.11
205 0.1
206 0.1
207 0.09
208 0.07
209 0.05
210 0.05
211 0.04
212 0.04
213 0.03
214 0.04
215 0.04
216 0.04
217 0.03
218 0.05
219 0.06
220 0.07
221 0.07
222 0.1
223 0.11
224 0.13
225 0.16
226 0.2
227 0.2
228 0.25
229 0.3
230 0.32
231 0.35
232 0.38
233 0.39
234 0.35
235 0.36
236 0.34
237 0.37
238 0.37
239 0.33
240 0.32
241 0.29
242 0.28
243 0.27
244 0.24
245 0.17
246 0.13
247 0.11
248 0.09
249 0.08
250 0.07
251 0.08
252 0.06
253 0.06
254 0.07
255 0.07
256 0.07
257 0.09
258 0.1
259 0.16
260 0.21
261 0.25
262 0.25
263 0.25
264 0.32
265 0.33
266 0.36
267 0.33
268 0.36
269 0.33
270 0.38
271 0.42
272 0.36
273 0.34
274 0.31
275 0.28
276 0.2
277 0.19
278 0.16
279 0.12
280 0.13
281 0.12
282 0.15
283 0.17
284 0.16
285 0.17
286 0.19
287 0.17
288 0.17
289 0.19
290 0.18
291 0.21
292 0.26
293 0.31
294 0.37
295 0.43
296 0.54
297 0.61
298 0.69
299 0.72
300 0.73
301 0.73
302 0.73
303 0.71
304 0.64
305 0.59
306 0.56
307 0.55
308 0.5
309 0.45
310 0.37
311 0.33
312 0.3
313 0.25
314 0.2
315 0.15
316 0.15
317 0.17
318 0.21
319 0.22
320 0.23
321 0.24
322 0.22
323 0.22
324 0.25