Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397JA59

Protein Details
Accession A0A397JA59    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
23-42RPEGCHKHWKSKKCIPCKVFBasic
71-94RPEGCHKHWRSKKRVPCKVCDKSTBasic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 10, nucl 9.5, mito 8, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MSGNYTCNYIYNSGEVCNRSCCRPEGCHKHWKSKKCIPCKVFVKYTSSAPGKYTCNYIHNSSEVCNRGCCRPEGCHKHWRSKKRVPCKVCDKSTSSAPEACKDYAGGFYVLQFYSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.23
4 0.28
5 0.29
6 0.29
7 0.31
8 0.32
9 0.33
10 0.39
11 0.47
12 0.5
13 0.55
14 0.62
15 0.64
16 0.71
17 0.73
18 0.75
19 0.74
20 0.73
21 0.76
22 0.75
23 0.81
24 0.72
25 0.75
26 0.73
27 0.7
28 0.66
29 0.59
30 0.54
31 0.46
32 0.45
33 0.42
34 0.37
35 0.31
36 0.27
37 0.28
38 0.24
39 0.23
40 0.25
41 0.2
42 0.21
43 0.23
44 0.24
45 0.22
46 0.21
47 0.21
48 0.18
49 0.22
50 0.21
51 0.19
52 0.19
53 0.19
54 0.22
55 0.23
56 0.24
57 0.21
58 0.24
59 0.34
60 0.41
61 0.45
62 0.52
63 0.55
64 0.64
65 0.69
66 0.73
67 0.73
68 0.74
69 0.78
70 0.8
71 0.85
72 0.8
73 0.82
74 0.83
75 0.83
76 0.79
77 0.74
78 0.67
79 0.61
80 0.63
81 0.58
82 0.5
83 0.46
84 0.42
85 0.41
86 0.4
87 0.36
88 0.3
89 0.25
90 0.23
91 0.2
92 0.2
93 0.17
94 0.13
95 0.13
96 0.16