Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397IS29

Protein Details
Accession A0A397IS29    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MMNDRKTLREAKKDRRIKKEKIVEKTNKLNRKBasic
NLS Segment(s)
PositionSequence
8-32LREAKKDRRIKKEKIVEKTNKLNRK
Subcellular Location(s) nucl 25, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR039693  Rtr1/RPAP2  
IPR007308  Rtr1/RPAP2_dom  
IPR038534  Rtr1/RPAP2_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
GO:0043175  F:RNA polymerase core enzyme binding  
GO:0008420  F:RNA polymerase II CTD heptapeptide repeat phosphatase activity  
Pfam View protein in Pfam  
PF04181  RPAP2_Rtr1  
PROSITE View protein in PROSITE  
PS51479  ZF_RTR1  
Amino Acid Sequences MMNDRKTLREAKKDRRIKKEKIVEKTNKLNRKQQLLKKTAEQRMIFKNLTIEWQEKLYDPVDSTILQESAKYLLPHQYQEVIEERNAYNLCGYPLCSNNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.86
3 0.87
4 0.85
5 0.86
6 0.85
7 0.83
8 0.83
9 0.84
10 0.82
11 0.8
12 0.82
13 0.81
14 0.79
15 0.75
16 0.74
17 0.69
18 0.7
19 0.71
20 0.69
21 0.69
22 0.66
23 0.64
24 0.63
25 0.66
26 0.62
27 0.6
28 0.54
29 0.48
30 0.48
31 0.5
32 0.42
33 0.33
34 0.29
35 0.22
36 0.23
37 0.21
38 0.17
39 0.12
40 0.13
41 0.13
42 0.12
43 0.14
44 0.12
45 0.11
46 0.1
47 0.1
48 0.1
49 0.1
50 0.11
51 0.1
52 0.1
53 0.1
54 0.09
55 0.09
56 0.09
57 0.12
58 0.11
59 0.11
60 0.18
61 0.2
62 0.22
63 0.23
64 0.25
65 0.23
66 0.26
67 0.28
68 0.23
69 0.22
70 0.23
71 0.22
72 0.23
73 0.23
74 0.21
75 0.19
76 0.18
77 0.19
78 0.17
79 0.19
80 0.18