Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397G9W8

Protein Details
Accession A0A397G9W8    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
133-162GKEGIKQRITKNPKNKIHRLRGKNCGCNGHHydrophilic
NLS Segment(s)
PositionSequence
143-150KNPKNKIH
Subcellular Location(s) nucl 16.5, cyto_nucl 11, cyto 4.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036910  HMG_box_dom_sf  
Amino Acid Sequences MAYQVIQPLKDNKYDFIFETGGKITSETKKLQRNVNANQNIVRLVDVPFPPKLTEEDLIKPRNDKCCKLKVPNKFFIYRKWYTMCLADGGRKNDQTSISPYISEQWNKEPKEVKDYYGYLSKRASELFINKYGKEGIKQRITKNPKNKIHRLRGKNCGCNGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.35
3 0.33
4 0.31
5 0.25
6 0.26
7 0.24
8 0.21
9 0.18
10 0.18
11 0.18
12 0.22
13 0.26
14 0.29
15 0.35
16 0.42
17 0.47
18 0.54
19 0.57
20 0.6
21 0.63
22 0.68
23 0.65
24 0.59
25 0.56
26 0.49
27 0.42
28 0.34
29 0.26
30 0.17
31 0.14
32 0.17
33 0.16
34 0.17
35 0.17
36 0.18
37 0.18
38 0.18
39 0.18
40 0.17
41 0.18
42 0.19
43 0.24
44 0.29
45 0.32
46 0.31
47 0.33
48 0.33
49 0.41
50 0.42
51 0.42
52 0.43
53 0.49
54 0.56
55 0.62
56 0.65
57 0.66
58 0.69
59 0.71
60 0.69
61 0.65
62 0.6
63 0.56
64 0.57
65 0.49
66 0.44
67 0.37
68 0.35
69 0.3
70 0.3
71 0.24
72 0.18
73 0.17
74 0.19
75 0.21
76 0.23
77 0.24
78 0.23
79 0.23
80 0.23
81 0.23
82 0.21
83 0.22
84 0.23
85 0.21
86 0.2
87 0.2
88 0.21
89 0.24
90 0.24
91 0.21
92 0.24
93 0.31
94 0.32
95 0.37
96 0.4
97 0.38
98 0.45
99 0.44
100 0.38
101 0.36
102 0.36
103 0.35
104 0.36
105 0.35
106 0.29
107 0.29
108 0.28
109 0.23
110 0.23
111 0.22
112 0.19
113 0.24
114 0.26
115 0.32
116 0.34
117 0.33
118 0.34
119 0.36
120 0.32
121 0.33
122 0.35
123 0.36
124 0.43
125 0.49
126 0.53
127 0.6
128 0.68
129 0.72
130 0.75
131 0.77
132 0.77
133 0.81
134 0.87
135 0.87
136 0.89
137 0.89
138 0.9
139 0.88
140 0.89
141 0.89
142 0.87