Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397HYK2

Protein Details
Accession A0A397HYK2    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
70-97SSQCEEKMEKRTRKWYKKIFFRYNYYFEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 13, nucl 12.5, mito 12.5
Family & Domain DBs
Amino Acid Sequences MPKVSSASSYAKKYRACQSVTDQTENFLAERFIDDLRGQLVNTNRQSDFLTCVKQWDNEYKLGGWDQQWSSQCEEKMEKRTRKWYKKIFFRYNYYFEHLPNKLQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.55
3 0.51
4 0.49
5 0.52
6 0.56
7 0.57
8 0.56
9 0.47
10 0.41
11 0.4
12 0.36
13 0.28
14 0.18
15 0.13
16 0.09
17 0.1
18 0.1
19 0.08
20 0.09
21 0.09
22 0.09
23 0.11
24 0.11
25 0.09
26 0.12
27 0.15
28 0.2
29 0.22
30 0.25
31 0.23
32 0.24
33 0.25
34 0.22
35 0.24
36 0.18
37 0.19
38 0.16
39 0.18
40 0.18
41 0.19
42 0.2
43 0.22
44 0.23
45 0.22
46 0.23
47 0.21
48 0.21
49 0.2
50 0.19
51 0.13
52 0.15
53 0.14
54 0.18
55 0.2
56 0.22
57 0.25
58 0.27
59 0.27
60 0.26
61 0.31
62 0.32
63 0.39
64 0.47
65 0.51
66 0.54
67 0.64
68 0.72
69 0.77
70 0.82
71 0.83
72 0.83
73 0.86
74 0.91
75 0.9
76 0.86
77 0.85
78 0.82
79 0.76
80 0.71
81 0.66
82 0.57
83 0.49
84 0.51
85 0.44