Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397IYS9

Protein Details
Accession A0A397IYS9    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
68-89YEDFLRRKRLMLKRKKELENNKBasic
NLS Segment(s)
PositionSequence
74-84RKRLMLKRKKE
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008698  NDUB7  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0005758  C:mitochondrial intermembrane space  
GO:0070469  C:respirasome  
Pfam View protein in Pfam  
PF05676  NDUF_B7  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MAQTSLEDPDENPVMIATQQEMAEARLPLTHRDYCAHLLIPLNSCRFKNNFFPWKCEEERHAYEKCQYEDFLRRKRLMLKRKKELENNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.12
4 0.08
5 0.09
6 0.09
7 0.09
8 0.1
9 0.1
10 0.12
11 0.12
12 0.11
13 0.11
14 0.12
15 0.15
16 0.19
17 0.19
18 0.19
19 0.2
20 0.23
21 0.23
22 0.24
23 0.21
24 0.17
25 0.17
26 0.17
27 0.18
28 0.18
29 0.18
30 0.18
31 0.18
32 0.19
33 0.2
34 0.22
35 0.27
36 0.33
37 0.4
38 0.4
39 0.45
40 0.47
41 0.51
42 0.5
43 0.45
44 0.4
45 0.39
46 0.42
47 0.42
48 0.39
49 0.35
50 0.39
51 0.42
52 0.4
53 0.34
54 0.3
55 0.3
56 0.38
57 0.45
58 0.48
59 0.5
60 0.49
61 0.51
62 0.6
63 0.65
64 0.66
65 0.69
66 0.71
67 0.74
68 0.82
69 0.87