Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397IZ02

Protein Details
Accession A0A397IZ02    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
26-52RSVWDKREIQKKRRRSSRNRASKRSSIHydrophilic
NLS Segment(s)
PositionSequence
32-49REIQKKRRRSSRNRASKR
Subcellular Location(s) nucl 23, cyto_nucl 14.333, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MAKNEGSQEEEQSSSFPIRYETDDNRSVWDKREIQKKRRRSSRNRASKRSSIMLEYHSKLDQDPKDERSLSLLPRSERENNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.13
4 0.13
5 0.14
6 0.19
7 0.24
8 0.26
9 0.31
10 0.34
11 0.34
12 0.35
13 0.37
14 0.34
15 0.31
16 0.34
17 0.34
18 0.37
19 0.47
20 0.52
21 0.58
22 0.66
23 0.73
24 0.76
25 0.8
26 0.83
27 0.83
28 0.86
29 0.87
30 0.89
31 0.88
32 0.86
33 0.83
34 0.79
35 0.73
36 0.66
37 0.57
38 0.48
39 0.41
40 0.37
41 0.35
42 0.31
43 0.29
44 0.25
45 0.23
46 0.22
47 0.28
48 0.26
49 0.26
50 0.3
51 0.31
52 0.36
53 0.37
54 0.36
55 0.34
56 0.36
57 0.34
58 0.36
59 0.38
60 0.35
61 0.37
62 0.43