Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397GGJ3

Protein Details
Accession A0A397GGJ3    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
145-169DNIKENNTTKEKKRKYSRGKRKDEIBasic
NLS Segment(s)
PositionSequence
154-166KEKKRKYSRGKRK
Subcellular Location(s) cyto 14.5, cyto_nucl 14.5, nucl 11.5
Family & Domain DBs
Amino Acid Sequences MSEIFTWYSDSTKLFPEIALRDSFTIFDGDIGNIVDIGETCNIGEIGEIGETDKLYIGETVAPNFICHQLPIIIGETSDIGNIVDIGETCNIGEIGEIGETDKLYIGETGENSNKSSCVFYERNIRETFIPFFDNENNLIQQDLDNIKENNTTKEKKRKYSRGKRKDEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.22
4 0.23
5 0.24
6 0.24
7 0.22
8 0.21
9 0.21
10 0.21
11 0.16
12 0.14
13 0.11
14 0.11
15 0.1
16 0.09
17 0.09
18 0.09
19 0.08
20 0.07
21 0.07
22 0.06
23 0.05
24 0.06
25 0.06
26 0.05
27 0.05
28 0.06
29 0.06
30 0.06
31 0.06
32 0.04
33 0.05
34 0.05
35 0.05
36 0.05
37 0.05
38 0.05
39 0.05
40 0.06
41 0.05
42 0.06
43 0.06
44 0.06
45 0.08
46 0.09
47 0.09
48 0.1
49 0.1
50 0.1
51 0.11
52 0.13
53 0.1
54 0.09
55 0.09
56 0.09
57 0.09
58 0.1
59 0.1
60 0.08
61 0.08
62 0.08
63 0.07
64 0.07
65 0.06
66 0.05
67 0.04
68 0.03
69 0.04
70 0.03
71 0.03
72 0.03
73 0.05
74 0.05
75 0.05
76 0.05
77 0.06
78 0.06
79 0.06
80 0.06
81 0.04
82 0.05
83 0.05
84 0.05
85 0.05
86 0.05
87 0.05
88 0.05
89 0.06
90 0.05
91 0.05
92 0.06
93 0.06
94 0.06
95 0.07
96 0.1
97 0.13
98 0.13
99 0.14
100 0.14
101 0.14
102 0.14
103 0.14
104 0.11
105 0.16
106 0.17
107 0.19
108 0.29
109 0.31
110 0.35
111 0.35
112 0.36
113 0.31
114 0.33
115 0.33
116 0.24
117 0.23
118 0.19
119 0.21
120 0.22
121 0.22
122 0.21
123 0.21
124 0.2
125 0.18
126 0.18
127 0.15
128 0.12
129 0.15
130 0.15
131 0.15
132 0.18
133 0.19
134 0.2
135 0.26
136 0.28
137 0.3
138 0.37
139 0.41
140 0.47
141 0.58
142 0.65
143 0.7
144 0.79
145 0.83
146 0.86
147 0.91
148 0.93
149 0.93