Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397J7K8

Protein Details
Accession A0A397J7K8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
52-74VGSNNTKKGKREKGRREKVGFGNBasic
NLS Segment(s)
PositionSequence
58-69KKGKREKGRREK
Subcellular Location(s) mito 21, cyto 3.5, cyto_nucl 3.5
Family & Domain DBs
Amino Acid Sequences MITLDSPLAPNLPHTASSVTSTTTISSPQLPLSPPHVQFLIRRVLFINTSNVGSNNTKKGKREKGRREKVGFGNLKNSDLCVYNINENDITKIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.17
3 0.17
4 0.2
5 0.19
6 0.17
7 0.16
8 0.15
9 0.15
10 0.13
11 0.13
12 0.12
13 0.13
14 0.12
15 0.12
16 0.14
17 0.13
18 0.15
19 0.2
20 0.24
21 0.24
22 0.24
23 0.24
24 0.23
25 0.23
26 0.25
27 0.27
28 0.21
29 0.21
30 0.2
31 0.2
32 0.2
33 0.2
34 0.19
35 0.12
36 0.13
37 0.13
38 0.12
39 0.14
40 0.16
41 0.17
42 0.22
43 0.27
44 0.29
45 0.33
46 0.42
47 0.5
48 0.58
49 0.67
50 0.71
51 0.76
52 0.84
53 0.89
54 0.85
55 0.82
56 0.78
57 0.78
58 0.72
59 0.63
60 0.61
61 0.52
62 0.49
63 0.41
64 0.36
65 0.27
66 0.23
67 0.23
68 0.18
69 0.19
70 0.22
71 0.24
72 0.26
73 0.26
74 0.25