Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397GN09

Protein Details
Accession A0A397GN09    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
95-121IISIFCRNPKCRNPKCRNPKSQIPNYNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 10, mito 5, cyto 1.5
Family & Domain DBs
Amino Acid Sequences MYKAFLPSSREDLYNLELTYLFRPWIIPATQIQNPNAEIPNAEIPNPKLQLVSSQIPNTSNLCILAFQIIPAAQIQNPNAEIPNAEIPNPKSQIIISIFCRNPKCRNPKCRNPKSQIPNYN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.26
3 0.21
4 0.19
5 0.2
6 0.2
7 0.18
8 0.14
9 0.11
10 0.11
11 0.11
12 0.15
13 0.14
14 0.14
15 0.16
16 0.22
17 0.26
18 0.29
19 0.28
20 0.26
21 0.26
22 0.27
23 0.25
24 0.19
25 0.15
26 0.15
27 0.19
28 0.17
29 0.17
30 0.17
31 0.18
32 0.23
33 0.23
34 0.21
35 0.16
36 0.15
37 0.17
38 0.2
39 0.21
40 0.19
41 0.19
42 0.19
43 0.2
44 0.21
45 0.19
46 0.15
47 0.12
48 0.1
49 0.09
50 0.08
51 0.08
52 0.08
53 0.06
54 0.06
55 0.06
56 0.05
57 0.06
58 0.06
59 0.07
60 0.06
61 0.08
62 0.09
63 0.1
64 0.11
65 0.11
66 0.11
67 0.1
68 0.1
69 0.11
70 0.16
71 0.14
72 0.15
73 0.18
74 0.2
75 0.27
76 0.29
77 0.26
78 0.21
79 0.21
80 0.26
81 0.26
82 0.28
83 0.25
84 0.32
85 0.33
86 0.39
87 0.45
88 0.44
89 0.49
90 0.55
91 0.62
92 0.63
93 0.73
94 0.77
95 0.83
96 0.9
97 0.92
98 0.93
99 0.9
100 0.91
101 0.9