Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397I4H3

Protein Details
Accession A0A397I4H3    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
33-66FSSSAKSKTIRKQPRQSKSKPKVNKNSNNVRYNLHydrophilic
NLS Segment(s)
PositionSequence
40-54KTIRKQPRQSKSKPK
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, mito 5
Family & Domain DBs
Amino Acid Sequences MGKTSGRITRSMTTNNKTPKNKNLNSNKDNTPFSSSAKSKTIRKQPRQSKSKPKVNKNSNNVRYNLRARSVNET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.59
3 0.63
4 0.65
5 0.66
6 0.67
7 0.7
8 0.71
9 0.73
10 0.75
11 0.76
12 0.73
13 0.73
14 0.68
15 0.62
16 0.58
17 0.5
18 0.45
19 0.36
20 0.33
21 0.34
22 0.29
23 0.28
24 0.31
25 0.32
26 0.33
27 0.39
28 0.48
29 0.52
30 0.61
31 0.69
32 0.74
33 0.81
34 0.84
35 0.86
36 0.87
37 0.86
38 0.87
39 0.86
40 0.87
41 0.87
42 0.89
43 0.9
44 0.88
45 0.89
46 0.88
47 0.84
48 0.77
49 0.71
50 0.68
51 0.65
52 0.61
53 0.55
54 0.51