Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397HTE2

Protein Details
Accession A0A397HTE2    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
7-33SEYNQKNYNKRWWYKPYKSKHFQNDLIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, mito_nucl 9.5, cyto 6, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011009  Kinase-like_dom_sf  
IPR001245  Ser-Thr/Tyr_kinase_cat_dom  
Gene Ontology GO:0004672  F:protein kinase activity  
GO:0006468  P:protein phosphorylation  
Pfam View protein in Pfam  
PF07714  PK_Tyr_Ser-Thr  
Amino Acid Sequences MAYDMYSEYNQKNYNKRWWYKPYKSKHFQNDLIIKHKIDKFIQNAQFSGSNRMATEVLDEEEYTKAADVYSFAIIASDIISDFQPYSDVPMMKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.6
3 0.65
4 0.69
5 0.74
6 0.78
7 0.8
8 0.83
9 0.84
10 0.84
11 0.86
12 0.86
13 0.86
14 0.83
15 0.77
16 0.76
17 0.73
18 0.66
19 0.63
20 0.56
21 0.46
22 0.43
23 0.41
24 0.35
25 0.3
26 0.31
27 0.3
28 0.37
29 0.42
30 0.37
31 0.35
32 0.33
33 0.34
34 0.3
35 0.3
36 0.23
37 0.18
38 0.16
39 0.18
40 0.16
41 0.13
42 0.13
43 0.09
44 0.09
45 0.09
46 0.09
47 0.08
48 0.08
49 0.09
50 0.07
51 0.06
52 0.06
53 0.05
54 0.06
55 0.05
56 0.07
57 0.07
58 0.07
59 0.07
60 0.07
61 0.07
62 0.07
63 0.06
64 0.05
65 0.04
66 0.05
67 0.06
68 0.07
69 0.07
70 0.07
71 0.08
72 0.08
73 0.13
74 0.18