Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397ITW2

Protein Details
Accession A0A397ITW2    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MKKKGEKRKREKIKRKKIRPKRHTNQPISVEIBasic
NLS Segment(s)
PositionSequence
2-22KKKGEKRKREKIKRKKIRPKR
Subcellular Location(s) nucl 18.5, cyto_nucl 14, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MKKKGEKRKREKIKRKKIRPKRHTNQPISVEISNIIADDEVLNISSEDEMEEMEEISIESEEESADEFSNIFEDYSSPNYDPDEPIDPKSTNNNSYLWILLWIMSFRIKFNLPETATELLIKFIKLLLSEIGNSEFDTFPNSIYMTKKELGLRDDFYSFSTCPKCHKLYNKQEVEDYKENDXYAIFTLFLHYSYAILTSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.96
2 0.97
3 0.97
4 0.97
5 0.97
6 0.97
7 0.97
8 0.95
9 0.95
10 0.95
11 0.92
12 0.9
13 0.84
14 0.78
15 0.71
16 0.61
17 0.51
18 0.4
19 0.33
20 0.23
21 0.18
22 0.12
23 0.07
24 0.07
25 0.06
26 0.06
27 0.05
28 0.05
29 0.05
30 0.05
31 0.06
32 0.06
33 0.05
34 0.05
35 0.05
36 0.05
37 0.05
38 0.05
39 0.05
40 0.04
41 0.04
42 0.04
43 0.05
44 0.05
45 0.04
46 0.04
47 0.04
48 0.04
49 0.04
50 0.05
51 0.05
52 0.06
53 0.06
54 0.06
55 0.05
56 0.06
57 0.06
58 0.05
59 0.05
60 0.05
61 0.07
62 0.1
63 0.12
64 0.11
65 0.12
66 0.13
67 0.14
68 0.14
69 0.15
70 0.18
71 0.17
72 0.19
73 0.22
74 0.21
75 0.21
76 0.27
77 0.28
78 0.25
79 0.25
80 0.23
81 0.22
82 0.22
83 0.21
84 0.14
85 0.11
86 0.09
87 0.08
88 0.07
89 0.06
90 0.06
91 0.07
92 0.07
93 0.07
94 0.09
95 0.09
96 0.1
97 0.12
98 0.18
99 0.17
100 0.19
101 0.22
102 0.21
103 0.2
104 0.2
105 0.18
106 0.13
107 0.13
108 0.11
109 0.08
110 0.07
111 0.07
112 0.07
113 0.08
114 0.07
115 0.08
116 0.08
117 0.09
118 0.1
119 0.1
120 0.09
121 0.11
122 0.1
123 0.09
124 0.12
125 0.11
126 0.1
127 0.11
128 0.11
129 0.12
130 0.14
131 0.16
132 0.18
133 0.19
134 0.22
135 0.24
136 0.26
137 0.27
138 0.29
139 0.29
140 0.27
141 0.28
142 0.25
143 0.23
144 0.23
145 0.2
146 0.22
147 0.24
148 0.23
149 0.28
150 0.34
151 0.37
152 0.42
153 0.52
154 0.57
155 0.64
156 0.74
157 0.75
158 0.7
159 0.72
160 0.68
161 0.67
162 0.63
163 0.55
164 0.48
165 0.42
166 0.4
167 0.34
168 0.31
169 0.23
170 0.17
171 0.15
172 0.11
173 0.12
174 0.12
175 0.12
176 0.12
177 0.12
178 0.1
179 0.1