Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397JW10

Protein Details
Accession A0A397JW10    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
3-30NSISLIKNLKRTRKSKNTKKFKTFDSESHydrophilic
NLS Segment(s)
PositionSequence
12-21KRTRKSKNTK
Subcellular Location(s) nucl 12, mito_nucl 11.833, mito 10.5, cyto_nucl 8.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR041698  Methyltransf_25  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0008168  F:methyltransferase activity  
GO:0032259  P:methylation  
Pfam View protein in Pfam  
PF13649  Methyltransf_25  
CDD cd02440  AdoMet_MTases  
Amino Acid Sequences MGNSISLIKNLKRTRKSKNTKKFKTFDSESNESDDSHICSYISDTPTNGSKGRYIFSDKFDESERIKRKHFVLKYIFEENFSAPIKDLLTNGCRVLDIGCGPGTWILDMASEYTQSSFVGLDIFNMFPSEIKPHNTDFILADARDNLPFESNYFDYIHLGDMGYCFTEYEFDCVVTECIRVLKPGGWIEFQEIQHFMNNKGPYTEKFESLTTNWTNSKEIRVSPYSQNDMKKIPKMTNINQIVKPIPLGSWGGKLGEEFVESFTVLFYYVAEPVAKLHNCLVEEIHELINNMQPEFSEYKSSYDFFRTFGQKEYSENNE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.77
3 0.85
4 0.86
5 0.89
6 0.91
7 0.92
8 0.94
9 0.9
10 0.85
11 0.84
12 0.78
13 0.75
14 0.73
15 0.68
16 0.58
17 0.58
18 0.51
19 0.42
20 0.38
21 0.31
22 0.25
23 0.21
24 0.2
25 0.14
26 0.14
27 0.16
28 0.21
29 0.22
30 0.2
31 0.19
32 0.22
33 0.26
34 0.29
35 0.27
36 0.22
37 0.23
38 0.24
39 0.25
40 0.26
41 0.3
42 0.31
43 0.34
44 0.39
45 0.36
46 0.36
47 0.37
48 0.38
49 0.34
50 0.4
51 0.45
52 0.42
53 0.45
54 0.48
55 0.51
56 0.56
57 0.56
58 0.56
59 0.55
60 0.56
61 0.58
62 0.6
63 0.54
64 0.46
65 0.44
66 0.35
67 0.31
68 0.26
69 0.21
70 0.15
71 0.16
72 0.15
73 0.15
74 0.15
75 0.14
76 0.15
77 0.17
78 0.17
79 0.16
80 0.14
81 0.14
82 0.14
83 0.11
84 0.1
85 0.09
86 0.09
87 0.09
88 0.09
89 0.1
90 0.09
91 0.07
92 0.07
93 0.05
94 0.05
95 0.06
96 0.07
97 0.06
98 0.06
99 0.07
100 0.07
101 0.07
102 0.07
103 0.07
104 0.06
105 0.05
106 0.06
107 0.06
108 0.06
109 0.07
110 0.07
111 0.07
112 0.07
113 0.07
114 0.06
115 0.07
116 0.1
117 0.11
118 0.14
119 0.16
120 0.17
121 0.19
122 0.19
123 0.19
124 0.16
125 0.16
126 0.15
127 0.13
128 0.12
129 0.11
130 0.11
131 0.11
132 0.11
133 0.09
134 0.08
135 0.08
136 0.08
137 0.11
138 0.1
139 0.12
140 0.12
141 0.12
142 0.11
143 0.12
144 0.11
145 0.08
146 0.08
147 0.06
148 0.05
149 0.05
150 0.05
151 0.04
152 0.04
153 0.04
154 0.06
155 0.06
156 0.08
157 0.09
158 0.08
159 0.09
160 0.09
161 0.1
162 0.09
163 0.08
164 0.06
165 0.07
166 0.07
167 0.08
168 0.08
169 0.09
170 0.12
171 0.15
172 0.16
173 0.15
174 0.15
175 0.19
176 0.23
177 0.22
178 0.2
179 0.18
180 0.17
181 0.2
182 0.2
183 0.18
184 0.19
185 0.2
186 0.18
187 0.19
188 0.21
189 0.19
190 0.27
191 0.28
192 0.24
193 0.25
194 0.25
195 0.26
196 0.25
197 0.29
198 0.21
199 0.23
200 0.23
201 0.23
202 0.25
203 0.23
204 0.26
205 0.23
206 0.23
207 0.26
208 0.27
209 0.3
210 0.34
211 0.38
212 0.39
213 0.42
214 0.43
215 0.4
216 0.43
217 0.43
218 0.43
219 0.41
220 0.39
221 0.43
222 0.47
223 0.49
224 0.54
225 0.57
226 0.57
227 0.54
228 0.54
229 0.47
230 0.4
231 0.35
232 0.25
233 0.17
234 0.14
235 0.15
236 0.13
237 0.15
238 0.15
239 0.15
240 0.15
241 0.15
242 0.14
243 0.12
244 0.11
245 0.09
246 0.1
247 0.1
248 0.1
249 0.1
250 0.08
251 0.07
252 0.07
253 0.07
254 0.06
255 0.07
256 0.07
257 0.09
258 0.09
259 0.09
260 0.1
261 0.18
262 0.17
263 0.18
264 0.19
265 0.22
266 0.23
267 0.24
268 0.23
269 0.18
270 0.21
271 0.21
272 0.2
273 0.17
274 0.17
275 0.18
276 0.21
277 0.19
278 0.16
279 0.14
280 0.13
281 0.17
282 0.2
283 0.2
284 0.23
285 0.22
286 0.26
287 0.29
288 0.3
289 0.28
290 0.32
291 0.31
292 0.27
293 0.33
294 0.36
295 0.35
296 0.4
297 0.43
298 0.37
299 0.41