Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397IUX7

Protein Details
Accession A0A397IUX7    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
9-36QGTHGMRKSRTSKKKTNLHKRRKTSSTLHydrophilic
NLS Segment(s)
PositionSequence
15-31RKSRTSKKKTNLHKRRK
Subcellular Location(s) mito 10.5, cyto_mito 6.5, plas 6, nucl 5, cyto 1.5, extr 1, pero 1, E.R. 1, golg 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MFSLSLEPQGTHGMRKSRTSKKKTNLHKRRKTSSTLINNHLYKFQVPTRCQMLRFLGIGESFGFLAKISLLLLFCLFLFLFLFFLLIFVTNIEICKFV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.4
3 0.48
4 0.52
5 0.62
6 0.68
7 0.73
8 0.75
9 0.82
10 0.85
11 0.88
12 0.88
13 0.89
14 0.9
15 0.89
16 0.88
17 0.84
18 0.79
19 0.75
20 0.74
21 0.72
22 0.68
23 0.64
24 0.62
25 0.58
26 0.52
27 0.46
28 0.37
29 0.27
30 0.25
31 0.24
32 0.24
33 0.24
34 0.27
35 0.32
36 0.32
37 0.32
38 0.32
39 0.3
40 0.24
41 0.23
42 0.2
43 0.15
44 0.13
45 0.13
46 0.1
47 0.09
48 0.07
49 0.06
50 0.06
51 0.05
52 0.05
53 0.04
54 0.04
55 0.04
56 0.05
57 0.05
58 0.05
59 0.06
60 0.06
61 0.06
62 0.07
63 0.06
64 0.06
65 0.07
66 0.06
67 0.07
68 0.06
69 0.07
70 0.05
71 0.06
72 0.06
73 0.06
74 0.06
75 0.06
76 0.07
77 0.08
78 0.09