Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397GP25

Protein Details
Accession A0A397GP25    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
42-69INKRHHSVYKRHNHKRHNHKRQTEACTNBasic
NLS Segment(s)
PositionSequence
51-57KRHNHKR
Subcellular Location(s) extr 8, E.R. 4, golg 4, nucl 3, mito 3, pero 3, mito_nucl 3
Family & Domain DBs
Amino Acid Sequences MQFFKFLQTLALIAIFYIVIAASQPLDYNERHENTSVKRHQINKRHHSVYKRHNHKRHNHKRQTEACTNEDPNNESDKFAVKSCKRPDGTPYIESVDNKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.06
3 0.05
4 0.04
5 0.03
6 0.03
7 0.03
8 0.04
9 0.04
10 0.04
11 0.05
12 0.06
13 0.09
14 0.09
15 0.14
16 0.2
17 0.21
18 0.22
19 0.23
20 0.26
21 0.27
22 0.37
23 0.36
24 0.36
25 0.4
26 0.47
27 0.54
28 0.59
29 0.66
30 0.65
31 0.69
32 0.69
33 0.67
34 0.65
35 0.65
36 0.66
37 0.66
38 0.69
39 0.71
40 0.73
41 0.78
42 0.81
43 0.84
44 0.85
45 0.87
46 0.86
47 0.83
48 0.85
49 0.84
50 0.83
51 0.79
52 0.72
53 0.64
54 0.6
55 0.56
56 0.49
57 0.43
58 0.36
59 0.31
60 0.31
61 0.28
62 0.23
63 0.21
64 0.21
65 0.21
66 0.22
67 0.3
68 0.29
69 0.39
70 0.45
71 0.54
72 0.52
73 0.53
74 0.57
75 0.57
76 0.59
77 0.51
78 0.48
79 0.43
80 0.44