Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397JQM7

Protein Details
Accession A0A397JQM7    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MSLEKPTKKSSRHNRYNKKCRLEREQKLTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 8.5, plas 5, mito 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSLEKPTKKSSRHNRYNKKCRLEREQKLTIPDFIFVKKILFVKCCAISLIAVSIINQQKPSSSSRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.9
3 0.95
4 0.93
5 0.92
6 0.87
7 0.84
8 0.83
9 0.83
10 0.81
11 0.78
12 0.76
13 0.68
14 0.66
15 0.6
16 0.52
17 0.41
18 0.34
19 0.26
20 0.19
21 0.17
22 0.13
23 0.12
24 0.11
25 0.14
26 0.15
27 0.16
28 0.17
29 0.21
30 0.21
31 0.21
32 0.2
33 0.17
34 0.15
35 0.14
36 0.13
37 0.1
38 0.08
39 0.08
40 0.15
41 0.18
42 0.2
43 0.2
44 0.2
45 0.21
46 0.24