Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397HLW6

Protein Details
Accession A0A397HLW6    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MDNQNCSIQKKKKKTENKFMLSKSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 12.333, nucl 12, mito 11.5, cyto_nucl 8.333
Family & Domain DBs
Amino Acid Sequences MDNQNCSIQKKKKKTENKFMLSKSNLVKFRDIIKETYTPALTNPGILPFPIFHSPISIKKKSDVHMLALIIKEKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.9
3 0.91
4 0.89
5 0.86
6 0.79
7 0.77
8 0.68
9 0.63
10 0.56
11 0.53
12 0.5
13 0.43
14 0.42
15 0.35
16 0.38
17 0.39
18 0.36
19 0.3
20 0.28
21 0.28
22 0.27
23 0.28
24 0.23
25 0.16
26 0.15
27 0.17
28 0.14
29 0.13
30 0.12
31 0.11
32 0.11
33 0.11
34 0.11
35 0.07
36 0.11
37 0.13
38 0.14
39 0.12
40 0.16
41 0.19
42 0.27
43 0.35
44 0.35
45 0.35
46 0.4
47 0.45
48 0.44
49 0.51
50 0.45
51 0.42
52 0.42
53 0.42
54 0.39
55 0.35