Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397JEK8

Protein Details
Accession A0A397JEK8    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
65-94YGYCDPHAQKHRRKEYRHQKKLEKLAQKLEBasic
NLS Segment(s)
PositionSequence
75-85HRRKEYRHQKK
Subcellular Location(s) nucl 13.5, mito 13, cyto_nucl 7.5
Family & Domain DBs
Amino Acid Sequences MKINSKEYWSTSKRMAFYRCPYILRTGEVCNRECYHPKGCKVHRDSPICYPCKEYGCVKFTSSDYGYCDPHAQKHRRKEYRHQKKLEKLAQKLEALGKNV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.51
3 0.5
4 0.52
5 0.57
6 0.54
7 0.5
8 0.48
9 0.48
10 0.44
11 0.39
12 0.35
13 0.31
14 0.34
15 0.36
16 0.35
17 0.33
18 0.33
19 0.34
20 0.36
21 0.35
22 0.38
23 0.4
24 0.44
25 0.49
26 0.52
27 0.58
28 0.61
29 0.65
30 0.65
31 0.64
32 0.6
33 0.6
34 0.63
35 0.56
36 0.49
37 0.44
38 0.38
39 0.36
40 0.35
41 0.3
42 0.28
43 0.29
44 0.3
45 0.27
46 0.27
47 0.25
48 0.28
49 0.25
50 0.2
51 0.21
52 0.22
53 0.22
54 0.21
55 0.25
56 0.21
57 0.27
58 0.36
59 0.41
60 0.47
61 0.57
62 0.67
63 0.72
64 0.78
65 0.81
66 0.83
67 0.86
68 0.88
69 0.87
70 0.86
71 0.86
72 0.9
73 0.88
74 0.86
75 0.81
76 0.79
77 0.75
78 0.66
79 0.6
80 0.57