Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397J3B0

Protein Details
Accession A0A397J3B0    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
32-51NNNFKHKYKKNTSNNNDKTSHydrophilic
54-80DEEVQKSTSKKKVKKSRISKESQLSEIHydrophilic
NLS Segment(s)
PositionSequence
63-70KKKVKKSR
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MALNDKDDFVVFFGKYKGLSKSQHMVIYVNINNNFKHKYKKNTSNNNDKTSSSDEEVQKSTSKKKVKKSRISKESQLSEIELE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.18
4 0.2
5 0.23
6 0.26
7 0.3
8 0.35
9 0.37
10 0.38
11 0.36
12 0.33
13 0.28
14 0.31
15 0.28
16 0.27
17 0.26
18 0.25
19 0.24
20 0.27
21 0.29
22 0.24
23 0.31
24 0.33
25 0.4
26 0.48
27 0.58
28 0.65
29 0.73
30 0.77
31 0.8
32 0.8
33 0.76
34 0.68
35 0.58
36 0.52
37 0.46
38 0.42
39 0.32
40 0.32
41 0.29
42 0.3
43 0.31
44 0.29
45 0.28
46 0.28
47 0.32
48 0.35
49 0.42
50 0.46
51 0.56
52 0.65
53 0.73
54 0.81
55 0.85
56 0.88
57 0.88
58 0.89
59 0.88
60 0.86
61 0.81
62 0.73
63 0.64