Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397IPD5

Protein Details
Accession A0A397IPD5    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
50-75TKIETSRKEKKKIRSIRKDEKNDDNNBasic
NLS Segment(s)
PositionSequence
20-67KIKEAPKRLAALKKLTVPKRPTTLRSNKRITKIETSRKEKKKIRSIRK
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, cyto 4.5, mito 4
Family & Domain DBs
Amino Acid Sequences MSIFEVCKVSPISIVAKVLKIKEAPKRLAALKKLTVPKRPTTLRSNKRITKIETSRKEKKKIRSIRKDEKNDDNNDETNESDKVYKVNEAYEIDEGDEYHNEIINIDESEKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.2
3 0.23
4 0.25
5 0.25
6 0.26
7 0.26
8 0.3
9 0.36
10 0.42
11 0.42
12 0.42
13 0.45
14 0.48
15 0.52
16 0.51
17 0.48
18 0.44
19 0.48
20 0.53
21 0.54
22 0.56
23 0.53
24 0.53
25 0.55
26 0.55
27 0.53
28 0.55
29 0.61
30 0.61
31 0.65
32 0.69
33 0.66
34 0.69
35 0.69
36 0.63
37 0.62
38 0.62
39 0.64
40 0.64
41 0.67
42 0.7
43 0.72
44 0.77
45 0.74
46 0.74
47 0.75
48 0.76
49 0.79
50 0.8
51 0.83
52 0.85
53 0.88
54 0.88
55 0.83
56 0.83
57 0.79
58 0.72
59 0.67
60 0.6
61 0.51
62 0.44
63 0.39
64 0.29
65 0.24
66 0.2
67 0.16
68 0.14
69 0.13
70 0.12
71 0.12
72 0.15
73 0.13
74 0.14
75 0.17
76 0.18
77 0.19
78 0.2
79 0.19
80 0.17
81 0.16
82 0.15
83 0.13
84 0.12
85 0.11
86 0.11
87 0.11
88 0.1
89 0.1
90 0.12
91 0.12
92 0.12