Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397G3P7

Protein Details
Accession A0A397G3P7    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
2-43GNSASKRLMTEKKLRKKKSRARSLSNRSNKSNKSNNNNTQSLHydrophilic
NLS Segment(s)
PositionSequence
12-26EKKLRKKKSRARSLS
Subcellular Location(s) nucl 14, mito_nucl 13.166, mito 10, cyto_nucl 8.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR013216  Methyltransf_11  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0008168  F:methyltransferase activity  
Pfam View protein in Pfam  
PF08241  Methyltransf_11  
CDD cd02440  AdoMet_MTases  
Amino Acid Sequences MGNSASKRLMTEKKLRKKKSRARSLSNRSNKSNKSNNNNTQSLNSISSFESNSDCGSITSSNIYIPKESDISRSIAHNIAMNKLFGCAYSSPIEEFLTMTGKILDVGCGSGTWLIEMAHMYPKPEYFGIDLNPCTTIPYPSNTKIIKGNLLNLPYDENQFDFVRMSDFVTEFTDNEWEQSIAEMIRVTKPGGWIEFCEADLVSPENAPTFSKFLKSFTECLILRGVNCTITTKLEYLLYSTKQVEDIQCTVKPVIFGNKGGFIGTTTFDNFTSWFNDDVCIEMVADHMGITQDEYKKLWAIVENETIIDSVSTKFYRFWAQKKYE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.84
3 0.87
4 0.89
5 0.92
6 0.92
7 0.93
8 0.92
9 0.92
10 0.93
11 0.93
12 0.92
13 0.93
14 0.89
15 0.85
16 0.85
17 0.81
18 0.79
19 0.79
20 0.77
21 0.77
22 0.8
23 0.82
24 0.81
25 0.77
26 0.7
27 0.62
28 0.56
29 0.49
30 0.41
31 0.32
32 0.26
33 0.23
34 0.23
35 0.21
36 0.19
37 0.17
38 0.15
39 0.15
40 0.14
41 0.13
42 0.11
43 0.13
44 0.12
45 0.11
46 0.12
47 0.12
48 0.14
49 0.16
50 0.17
51 0.16
52 0.16
53 0.18
54 0.19
55 0.19
56 0.2
57 0.2
58 0.21
59 0.22
60 0.22
61 0.22
62 0.21
63 0.21
64 0.21
65 0.19
66 0.22
67 0.21
68 0.2
69 0.17
70 0.17
71 0.16
72 0.12
73 0.14
74 0.1
75 0.12
76 0.14
77 0.15
78 0.14
79 0.15
80 0.16
81 0.13
82 0.12
83 0.1
84 0.1
85 0.1
86 0.09
87 0.08
88 0.08
89 0.09
90 0.08
91 0.08
92 0.06
93 0.06
94 0.06
95 0.05
96 0.06
97 0.06
98 0.06
99 0.05
100 0.05
101 0.05
102 0.05
103 0.06
104 0.07
105 0.1
106 0.11
107 0.11
108 0.12
109 0.12
110 0.13
111 0.13
112 0.13
113 0.1
114 0.12
115 0.14
116 0.16
117 0.16
118 0.14
119 0.15
120 0.14
121 0.14
122 0.13
123 0.13
124 0.12
125 0.15
126 0.19
127 0.2
128 0.27
129 0.25
130 0.26
131 0.28
132 0.28
133 0.3
134 0.26
135 0.28
136 0.24
137 0.25
138 0.23
139 0.2
140 0.21
141 0.16
142 0.17
143 0.13
144 0.1
145 0.12
146 0.12
147 0.12
148 0.09
149 0.09
150 0.09
151 0.09
152 0.09
153 0.07
154 0.07
155 0.08
156 0.09
157 0.1
158 0.09
159 0.09
160 0.11
161 0.1
162 0.1
163 0.1
164 0.08
165 0.07
166 0.07
167 0.08
168 0.05
169 0.06
170 0.06
171 0.06
172 0.07
173 0.08
174 0.08
175 0.09
176 0.1
177 0.11
178 0.12
179 0.12
180 0.12
181 0.14
182 0.14
183 0.13
184 0.12
185 0.11
186 0.09
187 0.09
188 0.1
189 0.07
190 0.06
191 0.06
192 0.06
193 0.07
194 0.08
195 0.09
196 0.11
197 0.11
198 0.15
199 0.16
200 0.17
201 0.23
202 0.25
203 0.25
204 0.24
205 0.31
206 0.27
207 0.28
208 0.28
209 0.23
210 0.2
211 0.21
212 0.19
213 0.13
214 0.13
215 0.14
216 0.13
217 0.14
218 0.16
219 0.14
220 0.14
221 0.15
222 0.14
223 0.15
224 0.18
225 0.17
226 0.19
227 0.19
228 0.19
229 0.19
230 0.21
231 0.2
232 0.2
233 0.22
234 0.23
235 0.23
236 0.25
237 0.24
238 0.22
239 0.21
240 0.19
241 0.24
242 0.23
243 0.24
244 0.24
245 0.26
246 0.25
247 0.24
248 0.22
249 0.15
250 0.14
251 0.13
252 0.13
253 0.11
254 0.12
255 0.13
256 0.13
257 0.13
258 0.14
259 0.16
260 0.16
261 0.16
262 0.15
263 0.16
264 0.16
265 0.17
266 0.16
267 0.13
268 0.11
269 0.1
270 0.1
271 0.09
272 0.09
273 0.06
274 0.06
275 0.06
276 0.06
277 0.08
278 0.13
279 0.16
280 0.18
281 0.19
282 0.2
283 0.22
284 0.22
285 0.23
286 0.22
287 0.23
288 0.26
289 0.29
290 0.28
291 0.27
292 0.26
293 0.24
294 0.19
295 0.16
296 0.12
297 0.09
298 0.13
299 0.14
300 0.15
301 0.16
302 0.19
303 0.29
304 0.35
305 0.42